(data stored in ACNUC16935 zone)

EMBL: M14693

ID   M14693; SV 1; linear; genomic DNA; STD; VRT; 2207 BP.
XX
AC   M14693;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   27-JUN-2018 (Rel. 137, Last updated, Version 3)
XX
DE   Chicken ubiquitin I (UbI) gene, partial cds.
XX
KW   ubiquitin.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-2207
RX   PUBMED; 3025663.
RA   Bond U., Schlesinger M.J.;
RT   "The chicken ubiquitin gene contains a heat shock promoter and expresses an
RT   unstable mRNA in heat-shocked cells";
RL   Mol. Cell. Biol. 6(12):4602-4610(1986).
XX
DR   MD5; 5e5a2a540fc4740617c47635541106fa.
DR   Ensembl-Gn; ENSGALG00000004509; gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000039524; gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000061244; gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000088679; gallus_gallus.
DR   EuropePMC; PMC5823805; 28842808.
XX
CC   Original source text: Chicken embryo fibroblast (CEF), DNA (library
CC   of A. Axel).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2207
FT                   /organism="Gallus gallus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9031"
FT   prim_transcript 388..2169
FT                   /note="mRNA and intron"
FT   intron          445..1098
FT                   /note="ubiquitin, intron A"
FT   CDS_pept        1105..2022
FT                   /codon_start=1
FT                   /note="ubiquitin I"
FT                   /db_xref="GOA:P0CG62"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CG62"
FT                   /protein_id="AAA49128.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLSDYNIQKESTLHLVLRLRGGY"
XX
SQ   Sequence 2207 BP; 520 A; 495 C; 668 G; 524 T; 0 other;
     caatcagatt ctgcagcgct cgaatcttcc agagctttct tttcaacgct ctctccctat        60
     caaccaatca gcagccacct ttcttactgc tgcaccaatc agcgccgatc ttgccaccgt       120
     ttggagtagc cgtttcaccg caactccaga tccatccgca ccctcagaaa ttttggggtt       180
     attaagggtc tcagctctct gccgaagata tcgggacccc tttgctcctg aagagggatt       240
     ggagaggtag agaggcaagt atttgtttta ccaggggggt ttgtttggga ctactttgag       300
     aggtggatgg atacgtcagc ggagtgaggg gcggggcctg tctcgctgca gacgcataaa       360
     tacgggcggc gctgcgtcac ccgcagacca ctggtactgg aagcagattg acttgcgttg       420
     ggtactgcgc tcagggccgg agacgtgagt tgtgtggtgg gagcgccggg ccgggaggga       480
     aaaggcacgg cggttttttc ccgttaggga aacagagagg gttggagtga gttttcctcc       540
     ggtactcctt ccgaggaccg ttggttgcgg tggttgtgga gttccttaac ctgccttaac       600
     gcgttgttca aaaccggggt agacgggggg agggagggag ggagggaggg aggggggggg       660
     ggcagcttct gtctgagaaa ggtaggatgt tagaaagacg ggcggagcgc gtcgttgtgc       720
     tgcccggagg gggggagctg agtcagcgcc gggcggggca gcgcggctgc tgcagttctg       780
     tcaacgtgag agcccgcggg gggaggggaa ggggaaggag aaggggggtg tctgcctctg       840
     cggttacggg aaggggggac tgggctgtgc tgtgcttgcc tctggtctgc gcgagtactg       900
     cttgggcctt tagaagtatt gggtcttact ctaacaaaga gctggagaca ggagacggag       960
     gacagggtta gtaatagctt acagaaaccc tatgtgatat tagtgtaatg tggattagtg      1020
     agtctttttt catttataaa gcatgtgtgg acttaaggtg attttaccta agcctgaaac      1080
     ttctttatgt tttttcaggt aaacatgcag atcttcgtga agaccctgac tggcaagacc      1140
     atcacccttg aggttgagcc cagtgacacc attgagaacg tgaaggccaa gatccaagac      1200
     aaagaaggca ttcctcctga tcagcagagg ttgatctttg ctggcaagca gctggaagat      1260
     gggcgcaccc tgtctgacta caacatccag aaagagtcca ccctgcatct ggtgctgcgc      1320
     ctgaggggag gcatgcagat ctttgtgaag accttgactg gcaagaccat cacccttgag      1380
     gttgagccca gtgacacaat tgagaatgtg aaggccaaga tccaggataa agaaggcatt      1440
     cctcctgatc agcagaggtt gatctttgct ggtaagcagc tggaagacgg gcgcaccctg      1500
     tctgactaca acatccagaa agagtccacc ctgcatctgg tgttgcgcct gagaggtggg      1560
     atgcagatct tcgtgaaaac gttgactggc aagaccatca cccttgaggt tgagcccagt      1620
     gacaccattg aaaatgtgaa ggccaagatc caagacaaag aaggcattcc tcctgatcag      1680
     cagaggttga tctttgctgg caagcagctg gaagatgggc gcaccctgtc tgactacaac      1740
     atccagaaag agtccaccct gcatctggtg ctgcgcctga ggggaggcat gcagatcttt      1800
     gtgaagaccc tgactggcaa gaccatcacc ctcgaggttg agcctagtga caccattgag      1860
     aatgtgaagg ccaagatcca agacaaagaa ggcattcctc ctgatcagca gaggctgatt      1920
     tttgctggca agcagctgga agatgggcgc accctgtctg actacaacat ccagaaggag      1980
     tccaccctgc atctggtgct gcgcctcagg ggtggctatt agttgttgtc agcagtcttg      2040
     tcaagcaaga tgcacagcac attgtgtgtt gcactgtagt ctttctaatg tcttaaatta      2100
     aatgcaagct ttaagtaact gctgatctgt atgttgaaat gctaataaag tttttctgtt      2160
     gcacattaca ttctgttgtc tgttcaattt aagctattaa gcccagt                    2207
//

If you have problems or comments...

PBIL Back to PBIL home page