(data stored in ACNUC4932 zone)

EMBL: M15685

ID   M15685; SV 1; linear; mRNA; STD; ROD; 1086 BP.
XX
AC   M15685;
XX
DT   10-AUG-1990 (Rel. 25, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Rat 6-phosphofructo 2-kinase/fructose 2,6-bisphosphatase mRNA, 3' end.
XX
KW   6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1086
RX   DOI; 10.1016/0006-291X(87)90364-0.
RX   PUBMED; 3032183.
RA   Colosia A.D., Lively M., El-Maghrabi M.R., Pilkis S.J.;
RT   "Isolation of a cDNA clone for rat liver 6-phosphofructo 2-kinase/fructose
RT   2,6-bisphosphatase";
RL   Biochem. Biophys. Res. Commun. 143(3):1092-1098(1987).
XX
DR   MD5; 1ba5d8370e8bdad85beceba3d49f6fb3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1086
FT                   /organism="Rattus norvegicus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        <1..915
FT                   /codon_start=1
FT                   /note="6-phosphofructo 2-kinase/fructose 2,
FT                   6-bisphosphatase"
FT                   /db_xref="GOA:Q6LDV5"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LDV5"
FT                   /protein_id="AAA40624.1"
FT                   /translation="AENIKQVKLGSPDYIDCDQEKVLEDFLKRIECYEINYQPLDEELD
FT                   SHLSYIKIFDVGTRYMVNRVQDHVQSRTAYYLMNIHVTPRSIYLCRHGESELNLRGRIG
FT                   GDSGLSARGKQYAYALANFIRSQGISSLKVWTSHMKRTIQTAEALGVPYEQWKALNEID
FT                   AGVCEEMTYEEIQEHYPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVL
FT                   VICHQAVMRCLLAYFLDKSSDELPYLKCPLHTVLKLTPVAYGCRVESIYLNVEAVNTHR
FT                   DKPENVDITREAEEALDTVPAHY"
XX
SQ   Sequence 1086 BP; 290 A; 279 C; 264 G; 253 T; 0 other;
     gcagaaaaca tcaagcaagt gaaacttggt agtcctgatt acatagactg tgaccaagaa        60
     aaggttttgg aagactttct aaagagaata gagtgctatg agatcaacta ccaacctttg       120
     gatgaggaat tggacagcca cctgtcctac atcaagatct tcgacgtggg cacacgctac       180
     atggtaaatc gagtgcagga ccacgttcag agccgtacag cctactacct catgaacatc       240
     catgtcacac ctcgatctat ctacctatgc cgccatggtg agagtgaact caaccttaga       300
     ggccgcattg gaggtgactc tggcctctca gctcggggca agcagtatgc ctatgcacta       360
     gccaacttca tccggtctca aggcatcagc tccctgaaag tatggactag ccacatgaag       420
     aggaccattc agaccgctga agccctaggt gtcccctatg aacagtggaa ggccctgaat       480
     gagattgatg cgggtgtctg tgaagagatg acctatgaag aaattcagga acactaccct       540
     gaggaatttg cactacggga ccaggataaa tatcgttacc gctatccgaa gggagagtcc       600
     tatgaggatc tggttcagcg tcttgaacca gttataatgg agctagaacg gcaagaaaat       660
     gtactggtga tctgtcacca ggctgtcatg cggtgcctcc tggcatactt cctggataaa       720
     agttcagatg agctgcccta tctcaagtgt cctctgcata ctgtgctcaa actcacacct       780
     gtggcttatg gctgcagagt ggagtccatc tacctgaatg tggaggctgt gaacacacac       840
     cgggacaagc ctgagaatgt ggacatcacc cgtgaagctg aggaagcctt ggacactgta       900
     cctgcccatt actgagccct tttcaagtga tcagattgtc tctgttctca cccccttcct       960
     cctgtaggag ctgctgccct tgttctcctt aagcagactc tggctatggc ctgagagtgc      1020
     cctacctcca gtgaagaagt ccgtagcagc tcccaaacag gtctcaattc ctagccacaa      1080
     ctaagg                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page