(data stored in ACNUC16935 zone)

EMBL: M18159

ID   M18159; SV 1; linear; mRNA; STD; MAM; 832 BP.
XX
AC   M18159;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 4)
XX
DE   Pig poly-ubiquitin mRNA, 3' end.
XX
KW   ubiquitin.
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-832
RX   PUBMED; 2824145.
RA   Einspanier R., Sharma H.S., Scheit K.H.;
RT   "An mRNA encoding poly-ubiquitin in porcine corpus luteum: identification
RT   by cDNA cloning and sequencing";
RL   DNA 6(5):395-400(1987).
XX
DR   MD5; aabb58b7602d40e15ea4b5532ff65b8a.
DR   EuropePMC; PMC1896162; 17540017.
DR   EuropePMC; PMC4410308; 25736264.
DR   EuropePMC; PMC5667896; 28987956.
XX
CC   Draft entry and computer-readable sequence for [1] kindly provided
CC   by K.H.Scheit, 06-JAN-1988.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..832
FT                   /organism="Sus scrofa"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9823"
FT   mRNA            <1..832
FT                   /note="Ub mRNA"
FT   CDS_pept        <1..768
FT                   /codon_start=1
FT                   /note="poly-ubiquitin precursor"
FT                   /db_xref="GOA:P0CG68"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CG68"
FT                   /protein_id="AAA31133.1"
FT                   /translation="EDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEP
FT                   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQ
FT                   IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
FT                   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FT                   FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF"
FT   mat_peptide     <1..78
FT                   /note="ubiquitin copy 1"
FT   mat_peptide     79..306
FT                   /note="ubiquitin copy 2"
FT   mat_peptide     307..534
FT                   /note="ubiquitin copy 3"
FT   mat_peptide     535..765
FT                   /note="ubiquitin copy 4"
XX
SQ   Sequence 832 BP; 216 A; 239 C; 223 G; 154 T; 0 other;
     gaagatgggc gcaccctgtc tgactacaac atccagaagg agtccaccct gcacctggtc        60
     ctccgcctca gaggtgggat gcagatcttc gtgaagacct tgactggtaa gaccatcacc       120
     ctggaagtgg agcccagcga caccatcgag aatgtcaagg cgaagatcca agacaaggaa       180
     ggcatccccc cagaccagca gaggctgatc tttgccggga agcagctgga agatgggcgc       240
     accctgtctg actacaacat ccagaaggag tccaccctgc acctggtcct ccgcctcaga       300
     ggtgggatgc agatcttcgt gaagaccttg actggtaaga ccatcaccct ggaagtggag       360
     cccagcgaca ccatcgagaa tgtcaaggcg aagatccaag acaaggaagg catcccccca       420
     gaccagcaga ggctgatctt tgccgggaag cagctggaag atgggcgcac cctgtctgac       480
     tacaacatcc agaaggagtc caccctgcac ctggtcctcc gcctcagagg tgggatgcag       540
     atcttcgtga agaccttgac tggtaagacc atcaccctgg aagtggagcc cagcgacacc       600
     atcgagaacg tcaaggcgaa gatccaggac aaggaaggca tccccccaga ccagcagagg       660
     ctgatctttg ccgggaagca gctggaagat gggcgcaccc tgtctgacta caacatccag       720
     aaggagtcca ccctgcactt ggtcctgcgc ttgaggggag gtttctaagt tctccctttt       780
     aagctttcaa caaatttcat tgcacttttc tttcaataaa gttgttgcat tc               832
//

If you have problems or comments...

PBIL Back to PBIL home page