(data stored in SCRATCH zone)

GenBank: ECOSECA

LOCUS       ECOSECA                 3811 bp    DNA     linear   BCT 26-APR-1993
DEFINITION  Escherichia coli SecA protein gene, complete cds; mutT 5' end.
ACCESSION   M20791
VERSION     M20791.1
KEYWORDS    secA protein.
SOURCE      Escherichia coli
  ORGANISM  Escherichia coli
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 3811)
  AUTHORS   Schmidt,M.G., Rollo,E.E., Grodberg,J. and Oliver,D.B.
  TITLE     Nucleotide sequence of the secA gene and secA(Ts) mutations
            preventing protein export in Escherichia coli
  JOURNAL   J. Bacteriol. 170 (8), 3404-3414 (1988)
   PUBMED   2841285
COMMENT     Original source text: E.coli (strain MC4100) DNA.
            Draft entry and computer readable sequence [1] kindly submitted by
            M. Schmidt 28-SEPT-1988
            The mutT gene was identified in Mol. Gen. Genet. 206, 9-16 (1987)
            accession number Xo4831.
FEATURES             Location/Qualifiers
     source          1..3811
                     /organism="Escherichia coli"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:562"
     CDS_pept        317..760
                     /note="gene X peptide"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA24618.1"
                     /translation="MVAASLGLPALSNAAEPNAPAKATTRNHEPSAKVNFGQLALLEA
                     NTRRPNSNYSVDYWHQHAIRTVIRHLSFAMAPQTLPVAEESLPLQAQHLALLDTLSAL
                     LTQEGTPSEKGYRIDYAHFTPQAKFSTPVWISQAQGIRAGPQRLT"
     gene            822..3527
                     /gene="secA"
     CDS_pept        822..3527
                     /gene="secA"
                     /note="secA protein"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA24619.1"
                     /translation="MLIKLLTKVFGSRNDRTLRRMRKVVNIINAMEPEMEKLSDEELK
                     GKTAEFRARLEKGEVLENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEM
                     RTGEGKTLTATLPAYLNALTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPG
                     MPAPAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDE
                     ARTPLIISGPAEDSSEMYKRVNKIIPHLIRQEKEDSETFQGEGHFSVDEKSRQVNLTE
                     RGLVLIEELLVKEGIMDEGESLYSPANIMLMHHVTAALRAHALFTRDVDYIVKDGEVI
                     IVDEHTGRTMQGRRWSDGLHQAVEAKEGVQIQNENQTLASITFQNYFRLYEKLAGMTG
                     TADTEAFEFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTAKGQ
                     PVLVGTISIEKSELVSNELTKAGIKHNVLNAKFHANEAAIVAQAGYPAAVTIATNMAG
                     RGTDIVLGGSWQAEVAALENPTAEQIEKIKADWQVRHDAVLEAGGLHIIGTERHESRR
                     IDNQLRGRSGRQGDAGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVT
                     KAIANAQRKVESRNFDIRKQLLEYDDVANDQRRAIYSQRNELLDVSDVSETINSIRED
                     VFKATIDAYIPPQSLEEMWDIPGLQERLKNDFDLDLPIAEWLDKEPELHEETLRDGIL
                     AQSIEVYQRKEEVVGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKD
                     PKQEYKRESFSMFAAMLESLKYEVISTLSKVQVRMPEEVEELEQQRRMEAERLAQMQQ
                     LSHQDDDSAAAAALAAQTGERKVGRNDPCPCGSGKKYKQCHGRLQ"
     gene            3587..3811
                     /gene="mutT"
     CDS_pept        3587..>3811
                     /gene="mutT"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA24620.1"
                     /translation="MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGE
                     TPEQAVVRELQEEVGITPQHFSLFEKLEYEF"
ORIGIN      3 bp upstream of PvuII site.
        1 cagctgtact ggcataacga catttatact gtcgtataaa attcgactgg caaatctggc
       61 actctctccg gccaggtgaa ccagtcgttt ttttttgaat tttataagag ctataaaaaa
      121 cggtgcgaac gctgttttct taagcacttt tccgcacaac ttatcttcat tcgtgctgtg
      181 gactgcaggc tttaatgata agatttgtgc gctaaatacg tttgaatatg atcgggatgg
      241 caataacgtg agtggaatac tgacgcgctg gcgacagttt ggtaaacgct acttctggcc
      301 gcatctctta ttagggatgg ttgcggcgag tttaggtttg cctgcgctca gcaacgccgc
      361 cgaaccaaac gcgcccgcaa aagcgacaac ccgcaaccac gagccttcag ccaaagttaa
      421 ctttggtcaa ttggccttgc tggaagcgaa cacacgccgc ccgaattcga actattccgt
      481 tgattactgg catcaacatg ccattcgcac ggtaatccgt catctttctt tcgcaatggc
      541 accgcaaaca ctgcccgttg ctgaagaatc tttgcctctt caggcgcaac atcttgcatt
      601 actggatacg ctcagcgcgc tgctgaccca ggaaggcacg ccgtctgaaa agggttatcg
      661 cattgattat gcgcatttta ccccacaagc aaaattcagc acgcccgtct ggataagcca
      721 ggcgcaaggc atccgtgctg gccctcaacg cctcacctaa caacaataaa cctttacttc
      781 attttattaa ctccgcaacg cggggcgttt gagattttat tatgctaatc aaattgttaa
      841 ctaaagtttt cggtagtcgt aacgatcgca ccctgcgccg gatgcgcaaa gtggtcaaca
      901 tcatcaatgc catggaaccg gagatggaaa aactctccga cgaagaactg aaagggaaaa
      961 ccgcagagtt tcgtgcacgt ctggaaaaag gcgaagtgct ggaaaatctg atcccggaag
     1021 ctttcgccgt ggtacgtgag gcaagtaagc gcgtctttgg tatgcgtcac ttcgacgttc
     1081 agttactcgg cggtatggtt cttaacgaac gctgcatcgc cgaaatgcgt accggtgaag
     1141 gaaaaaccct gaccgcaacg ctgcctgctt acctgaacgc actaaccggt aaaggcgtgc
     1201 acgtagttac cgtcaacgac tacctggcgc aacgtgacgc cgaaaacaac cgtccgctgt
     1261 ttgaattcct tggcctgact gtcggtatca acctgccggg catgccagca ccggcaaagc
     1321 gcgaagctta cgcagctgac atcacttacg gtacgaacaa cgaatacggc tttgactacc
     1381 tgcgcgacaa catggcgttc agccctgaag aacgtgtaca gcgtaaactg cactatgcgc
     1441 tggtggacga agtggactcc atcctgatcg atgaagcgcg tacaccgctg atcatttccg
     1501 gcccggcaga agacagctcg gaaatgtata aacgcgtgaa taaaattatt ccgcacctga
     1561 tccgtcagga aaaagaagac tccgaaacct tccagggcga aggccacttc tcggtggacg
     1621 aaaaatctcg ccaggtgaac ctgaccgaac gtggtctggt gctgattgaa gaactgctgg
     1681 tgaaagaggg catcatggat gaaggggagt ctctgtactc tccggccaac atcatgctga
     1741 tgcaccacgt aacggcggcg ctgcgcgctc atgcgctgtt tacccgtgac gtcgactaca
     1801 tcgttaaaga tggtgaagtt atcatcgttg acgaacacac cggtcgtacc atgcagggcc
     1861 gtcgctggtc cgatggtctg caccaggctg tggaagcgaa agaaggtgtg cagatccaga
     1921 acgaaaacca aacgctggct tcgatcacct tccagaacta cttccgtctg tatgaaaaac
     1981 tggcggggat gaccggtact gctgataccg aagctttcga atttagctca atctacaagc
     2041 tggataccgt cgttgttccg accaaccgtc caatgattcg taaagatctg ccggacctgg
     2101 tctacatgac tgaagcggaa aaaattcagg cgatcattga agatatcaaa gaacgtactg
     2161 cgaaaggcca gccggtgctg gtgggtacta tctccatcga aaaatcggag ctggtgtcaa
     2221 acgaactgac caaagccggt attaagcaca acgtcctgaa cgccaaattc cacgccaacg
     2281 aagcggcgat tgttgctcag gcaggttatc cggctgcggt gactatcgcg accaatatgg
     2341 cgggtcgtgg tacagatatt gtgctcggtg gtagctggca ggcagaagtt gccgcgctgg
     2401 aaaatccgac cgcagagcaa attgaaaaaa ttaaagccga ctggcaggta cgtcacgatg
     2461 cggtactgga agcaggtggc ctgcatatca tcggtaccga gcgtcacgaa tcccgtcgta
     2521 tcgataacca gttgcgcggt cgttctggtc gtcaggggga tgctggttct tcccgtttct
     2581 acctgtcgat ggaagatgcg ctgatgcgta tttttgcttc cgaccgagta tccggcatga
     2641 tgcgtaaact gggtatgaag ccaggcgaag ccattgaaca cccgtgggtg actaaagcga
     2701 ttgccaacgc ccagcgtaaa gttgaaagcc gtaacttcga cattcgtaag caactgctgg
     2761 aatatgatga cgtggctaac gatcagcgtc gcgccattta ctcccagcgt aacgaactgt
     2821 tggatgtcag cgatgtgagc gaaaccatta acagcattcg tgaagatgtg ttcaaagcga
     2881 ccattgatgc ctacattcca ccacagtcgc tggaagaaat gtgggatatt ccggggctgc
     2941 aggaacgtct gaagaacgat ttcgacctcg atttgccaat tgccgagtgg ctggataaag
     3001 aaccagaact gcatgaagag acgctgcgtg acggcattct ggcgcagtcc atcgaagtgt
     3061 atcagcgtaa agaagaagtg gttggtgctg agatgatgcg tcacttcgag aaaggcgtca
     3121 tgctgcaaac gcttgactcc ctgtggaaag agcacctggc agcgatggac tatctgcgtc
     3181 agggtatcca cctgcgtggc tacgcacaga aagatccgaa gcaggaatac aaacgtgaat
     3241 cgttctccat gtttgcagcg atgctggagt cgttgaaata tgaagttatc agtacgctga
     3301 gcaaagttca ggtacgtatg cctgaagagg ttgaggagct ggaacaacag cgtcgtatgg
     3361 aagccgagcg tttagcgcaa atgcagcagc ttagccatca ggatgacgac tctgcagccg
     3421 cagctgcact ggcggcgcaa accggagagc gcaaagtagg acgtaacgat ccttgcccgt
     3481 gcggttctgg taaaaaatac aagcagtgcc atggccgcct gcaataaaag ctaactgttg
     3541 aagtaaaagg cgcaggattc tgcgcctttt ttataggttt aagacaatga aaaagctgca
     3601 aattgcggta ggtattattc gcaacgagaa caatgaaatc tttataacgc gtcgcgcagc
     3661 agatgcgcac atggcgaata aactggagtt tcccggcggt aaaattgaaa tgggtgaaac
     3721 gccggaacag gcggtggtgc gtgaacttca ggaagaagtc gggattaccc cccaacattt
     3781 ttcgctattt gaaaaactgg aatatgaatt c
//

If you have problems or comments...

PBIL Back to PBIL home page