(data stored in ACNUC16935 zone)

EMBL: M21321

ID   M21321; SV 1; linear; genomic DNA; STD; INV; 587 BP.
XX
AC   M21321;
XX
DT   20-FEB-1989 (Rel. 18, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   C.elegans ubiquitin A (UbiA) gene, 5' end.
XX
KW   ubiquitin.
XX
OS   Caenorhabditis elegans
OC   Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
OC   Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
OC   Caenorhabditis.
XX
RN   [1]
RP   1-587
RX   PUBMED; 2839490.
RA   Graham R.W., Van Doren K., Bektesh S., Candido E.P.M.;
RT   "Maturation of the major ubiquitin gene transcript in Caenorhabditis
RT   elegans involves the acquisition of a trans-spliced leader";
RL   J Biol Chem 263(21):10415-10419(1988).
XX
DR   MD5; 1c7d47b409fd1c585f0ee60232ba7c64.
DR   Ensembl-Gn; WBGene00006727; caenorhabditis_elegans.
DR   Ensembl-Tr; F25B5.4a.1; caenorhabditis_elegans.
DR   Ensembl-Tr; F25B5.4a.2; caenorhabditis_elegans.
XX
CC   A trans-splicing event joins a splice leader from chromosome 5 to
CC   the UbiA RNA from chromosome 3 prior to or completing the mature
CC   mRNA UbiA formation.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..587
FT                   /organism="Caenorhabditis elegans"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:6239"
FT   mRNA            23..>587
FT                   /note="ubiquitin A mRNA (put.); putative"
FT   misc_feature    472..473
FT                   /note="leader splice site (put.); putative"
FT   CDS_pept        478..>587
FT                   /codon_start=1
FT                   /note="ubiquitin A"
FT                   /db_xref="GOA:P0CG71"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CG71"
FT                   /protein_id="AAA28153.1"
FT                   /translation="MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIP"
XX
SQ   Sequence 587 BP; 138 A; 143 C; 109 G; 197 T; 0 other;
     aatcagttgt tatatgaatt attttcccat tttagcaata ctgcttggta gtatttcggt        60
     cagagaaacg aggacatcag ctgaacatct gcgtctctaa caacactcgg gaagcgagtc       120
     agtgtgcgcg tgcgttgggg ttttatccga tcgttgagcg ggcatacagc agtcatacac       180
     cccattcgac cagactccgc tcgcgtgcca ccttgtctcc attctcattt cacttgtctc       240
     tactcggaca ttactcctca tcgatagctc tttactacca ttttactttt tatgcctttc       300
     tttttcgttt gacttgccta tacgagtggg gacaagtttg ctttgttagt cttagctagt       360
     gtatcgattt tttgggtaat atttcgcaac tttctaggac tttctttcat aatcacctct       420
     tctctcgcct cctcattcca gttttattcg cactcatttt ctattttttc agcaatcatg       480
     caaatcttcg tcaaaacgtt gactggaaaa actatcaccc tggaggtgga ggcttccgat       540
     accatcgaaa atgtcaaagc caagatccaa gacaaggaag gaattcc                     587
//

If you have problems or comments...

PBIL Back to PBIL home page