(data stored in SCRATCH zone)

EMBL: M21657

ID   M21657; SV 1; linear; genomic DNA; STD; PRO; 273 BP.
XX
AC   M21657;
XX
DT   22-APR-1989 (Rel. 19, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   B.subtilis spoIVC locus sporulation protein gene, 5' end.
XX
KW   sporulation protein; transposon.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-273
RX   PUBMED; 2841290.
RA   Kunkel B., Sandman K.M., Panzer S., Youngman P., Losick R.;
RT   "The promoter for a sporulation gene in the spoIVC locus of Bacillus
RT   subtilis and its use in studies of temporal and spatial control of gene
RT   expression";
RL   J. Bacteriol. 170(8):3513-3522(1988).
XX
DR   MD5; feec41a7dd719c65f19ada1df460796b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..273
FT                   /organism="Bacillus subtilis"
FT                   /strain="W168"
FT                   /sub_strain="PY79"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   mRNA            109..>273
FT                   /note="spoIVC mRNA"
FT   misc_feature    112..113
FT                   /note="Tn917 insertion site"
FT   CDS_pept        145..>273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="spoIVC sporulation protein"
FT                   /db_xref="GOA:P12254"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12254"
FT                   /protein_id="AAA22803.1"
FT                   /translation="MVTGVFAALGFVVKELVFLVSYVKNNAFPQPLSSSEEKKYLEL"
XX
SQ   Sequence 273 BP; 76 A; 63 C; 55 G; 79 T; 0 other;
     aatattttta acatttgaag ttagtatgct gcttaccaaa gccggactcc cccgcgagaa        60
     atttcccggt acagacacag acagcctccc ggtcacatac atttacatat aggcttttgc       120
     ctacatactt ttgtggaggt gacgatggtg acaggtgttt tcgcagcgct cggctttgtt       180
     gttaaagagc ttgtcttttt agtatcttac gtgaaaaaca atgcctttcc acaaccgctc       240
     tcaagcagcg aagaaaaaaa atacttagag ctc                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page