(data stored in SCRATCH zone)

EMBL: M21672

ID   M21672; SV 1; linear; genomic DNA; STD; PRO; 904 BP.
XX
AC   M21672;
XX
DT   22-APR-1989 (Rel. 19, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 3)
XX
DE   B.subtilis 14kd and 17kd DNA-entry nuclease and competence-specific protein
DE   genes, complete cds.
XX
KW   competence-specific protein; DNA-entry nuclease.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-904
RX   PUBMED; 2841296.
RA   Vosman B., Kuiken G., Kooistra J., Venema G.;
RT   "Transformation in Bacillus subtilis: involvement of the 17-kilodalton
RT   DNA-entry nuclease and the competence-specific 18-kilodalton protein";
RL   J. Bacteriol. 170(8):3703-3710(1988).
XX
DR   MD5; 7a751e0682fc9a350bf8a162d4d5f7dc.
DR   GOA; P12667.
DR   GOA; P42403.
DR   InterPro; IPR001360; Glyco_hydro_1.
DR   InterPro; IPR017853; Glycoside_hydrolase_SF.
DR   InterPro; IPR018120; Glyco_hydro_1_AS.
DR   InterPro; IPR033132; Glyco_hydro_1_N_CS.
DR   UniProtKB/Swiss-Prot; P12667; NUCA_BACSU.
DR   UniProtKB/Swiss-Prot; P42403; BGLC_BACSU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..904
FT                   /organism="Bacillus subtilis"
FT                   /strain="W168"
FT                   /sub_strain="PY79"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        81..515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="17-kd DNA-entry nuclease"
FT                   /db_xref="InterPro:IPR029476"
FT                   /db_xref="UniProtKB/TrEMBL:Q45555"
FT                   /protein_id="AAA22411.1"
FT                   /translation="MAFPSDRYPETAKHIKDAINEGHSEVCTIDRDGAEERREQSLKDV
FT                   PSKKGYDRDEWPMAMCKEGGEGASVEYISPLTTAEQALGSGIGLPITQTAQRFYSQFSK
FT                   QYIEEEQHIDQIMEAARTFDFISSIYCISKGFYTSCNGLD"
FT   CDS_pept        156..515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="14-kd DNA-entry nuclease (gtg start codon)"
FT                   /db_xref="UniProtKB/TrEMBL:Q45556"
FT                   /protein_id="AAA22412.1"
FT                   /translation="MCTIDRDGAEERREQSLKDVPSKKGYDRDEWPMAMCKEGGEGASV
FT                   EYISPLTTAEQALGSGIGLPITQTAQRFYSQFSKQYIEEEQHIDQIMEAARTFDFISSI
FT                   YCISKGFYTSCNGLD"
FT   CDS_pept        418..816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="18-kd competence-specific protein (ttg start codon)"
FT                   /db_xref="GOA:P12669"
FT                   /db_xref="InterPro:IPR020354"
FT                   /db_xref="InterPro:IPR038691"
FT                   /db_xref="PDB:4MQD"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12669"
FT                   /protein_id="AAA22413.1"
FT                   /translation="MIKSWKPQELSISYHQFTVFQKDSTPPVMDWTDEAIEKGYAAADG
FT                   AISFEAQRNTKAFILFRLNSSETVNSYEKKVTVPFHVTENGIHIESIMSKRLSFDLPKG
FT                   DYQLTCWTVPAEMSDLHADTYIIDAVSV"
FT   regulatory      825..847
FT                   /note="pot. transcription termination signal; putative"
FT                   /regulatory_class="other"
XX
SQ   Sequence 904 BP; 285 A; 191 C; 201 G; 227 T; 0 other;
     ctgcagctgt cggcctgata aaaggagact ttttctcagc tgatcaaaaa acgtctcaaa        60
     cgaaagaata tgatgaaaca atggccttcc catctgaccg gtatcccgaa actgccaagc       120
     atattaagga tgcgataaat gaggggcact cagaggtgtg cactattgac agagacggag       180
     ctgaagaacg ccgcgagcaa tcattaaagg acgtaccttc caaaaagggg tatgacagag       240
     atgaatggcc aatggccatg tgcaaagaag gcggtgaggg agcttctgta gaatacattt       300
     ctccgctgac aaccgcggag caggctcttg ggtcgggcat cggcttaccg attacccaga       360
     cggcacaaag gttttattca caattcagta aacagtacat agaggaggaa cagcacattg       420
     atcaaatcat ggaagccgca agaactttcg atttcatatc atcaatttac tgtatttcaa       480
     aaggattcta cacctcctgt aatggattgg actgacgaag cgattgaaaa aggatatgct       540
     gcggcagacg gagccatttc ctttgaggca cagcgaaata caaaggcctt tattcttttt       600
     cgcctgaaca gttcagaaac agtaaactcc tacgaaaaaa aagtgactgt tccttttcat       660
     gtcacagaaa acggaattca tattgaaagc atcatgtcta aaagactgtc ctttgatctg       720
     cctaaaggag actatcaatt gacatgctgg actgtgccgg ctgaaatgtc agatttgcac       780
     gccgacactt atattattga tgctgtttct gtgtaatgaa aaacccctga gagaataact       840
     ctcagggact ctttataaac tttctccgtt tgtcttgatg acatcttgat accaataaaa       900
     gctt                                                                    904
//

If you have problems or comments...

PBIL Back to PBIL home page