(data stored in ACNUC16935 zone)

EMBL: AH001495

ID   AH001495; SV 2; linear; genomic DNA; STD; HUM; 890 BP.
XX
AC   AH001495; M20483; M21786; M31020;
XX
DT   03-AUG-2016 (Rel. 129, Created)
DT   03-AUG-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens 15-kDa protein gene, complete cds.
XX
KW   interferon-inducible protein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-890
RX   DOI; 10.1073/pnas.84.18.6394.
RX   PUBMED; 3476954.
RA   Reich N., Evans B., Levy D., Fahey D., Knight E.Jr., Darnell J.E.Jr.;
RT   "Interferon-induced transcription of a gene encoding a 15-kDa protein
RT   depends on an upstream enhancer element";
RL   Proc. Natl. Acad. Sci. U.S.A. 84(18):6394-6398(1987).
XX
DR   MD5; bf67ce473be456ccefcd38637ea05f3b.
XX
CC   On or before Aug 1, 2016 this sequence version replaced gi:186562,
CC   gi:186563, gi:186564.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..890
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   prim_transcript 126..>223
FT                   /note="ISG15 mRNA and intron"
FT   CDS_pept        join(203..205,338..832)
FT                   /codon_start=1
FT                   /note="15-kDa protein"
FT                   /protein_id="AAA36128.1"
FT                   /translation="MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQNIGVHAFQQRL
FT                   AVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTV
FT                   AHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGG
FT                   RS"
FT   exon            <203..205
FT                   /number=1
FT                   /note="15-kDa protein"
FT   intron          206..>223
FT                   /note="intron"
FT   gap             224..323
FT                   /estimated_length=unknown
FT   prim_transcript <324..>875
FT                   /note="ISG15 mRNA and intron"
FT   intron          <324..337
FT                   /note="intron"
FT   exon            338..>832
FT                   /number=2
FT                   /note="15-kDa protein"
XX
SQ   Sequence 890 BP; 164 A; 232 C; 273 G; 121 T; 100 other;
     gggcatgcct cgggaaaggg aaaccgaaac tgaagccaaa tttggccacc agcgcaggct        60
     cgcggcacgc cccctgacgt gtgtgcctca ggcttaataa tagggccggt gctgctgcgg       120
     aagccggcgg ctgagaggca gcgaactcat ctttgccagt acaggagctc gtgccgtggc       180
     ccacagccca cagcccacag ccatggtaag gcagatgtca cagnnnnnnn nnnnnnnnnn       240
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnntgtgacg cctgcagggc tgggacctga cggtgaagat       360
     gctggcgggc aacgaattcc aggtgtccct gagcagctcc atgtcggtgt cagagctgaa       420
     ggcgcagatc acccagaaca ttggcgtgca cgccttccag cagcgtctgg ctgtccaccc       480
     gagcggtgtg gcgctgcagg acagggtccc ccttgccagc cagggcctgg gccctggcag       540
     cacggtcctg ctggtggtgg acaaatgcga cgaacctctg agcatcctgg tgaggaataa       600
     caagggccgc agcagcacct acgaggtgcg gctgacgcag accgtggccc acctgaagca       660
     gcaagtgagc gggctggagg gtgtgcagga cgacctgttc tggctgacct tcgaggggaa       720
     gcccctggag gaccagctcc cgctggggga gtacggcctc aagcccctga gcaccgtgtt       780
     catgaatctg cgcctgcggg gaggcggcac agagcctggc gggcggagct aagggcctcc       840
     accagcatcc gagcaggatc aagggccgga ataaaggctg ttgtaagaga                  890
//

If you have problems or comments...

PBIL Back to PBIL home page