(data stored in SCRATCH zone)

EMBL: M23103

ID   M23103; SV 1; linear; genomic DNA; STD; PRO; 679 BP.
XX
AC   M23103;
XX
DT   06-JUL-1989 (Rel. 20, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   B.subtilis spoIVCB gene, complete cds.
XX
KW   alternative splicing; sigma factor; sigma K; spoIVCB gene;
KW   transcription factor.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-679
RX   DOI; 10.1126/science.2536191.
RX   PUBMED; 2536191.
RA   Stragier P., Kunkel B., Kroos L., Losick R.;
RT   "Chromosomal rearrangement generating a composite gene for a developmental
RT   transcription factor";
RL   Science, e1252229 243(4890):507-512(1989).
XX
DR   MD5; f8375012e14979dd288f04407705e634.
XX
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by B.Kunkel, 22-MAY-1989.
CC   The spoIVCB gene is an incomplete structural gene that is capable
CC   of encoding only the amino terminal half of RNA polymerase sigma
CC   factor K (sigma-K).  The remainder of sigma-K is specified by
CC   another regulatory gene, spoIIIC, that is about 10 kilobases from
CC   spoIVCB on the chromosome.  The recombination event appears to
CC   occur within a 5 base repeat sequence at an intermediate stage of
CC   sporulation.  See also accession M19299.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..679
FT                   /organism="Bacillus subtilis"
FT                   /strain="W168"
FT                   /sub_strain="PY79"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="vegetative stage"
FT                   /db_xref="taxon:1423"
FT   mRNA            109..679
FT                   /note="spoIVCB peptide mRNA"
FT   sig_peptide     148..207
FT                   /note="spoIVCB signal peptide"
FT   CDS_pept        148..615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="spoIVCB peptide precursor"
FT                   /db_xref="GOA:P12254"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12254"
FT                   /protein_id="AAA22804.1"
FT                   /translation="MTGVFAALGFVVKELVFLVSYVKNNAFPQPLSSSEEKKYLELMAK
FT                   GDEHARNMLIEHNLRLVAHIVKKFENTGEDAEDLISIGTIGLIKGIESYSAGKGTKLAT
FT                   YAARCIENEIVITKGGCIHPSLIRFNIYGVRIHNGNFFHDKVNNCFFIFKS"
FT   mat_peptide     208..612
FT                   /note="spoIVCB peptide"
XX
SQ   Sequence 679 BP; 203 A; 131 C; 148 G; 197 T; 0 other;
     aatattttta acatttgaag ttagtatgct gcttaccaaa gccggactcc cccgcgagaa        60
     atttcccggt acagacacag acagcctccc ggtcacatac atttacatat aggcttttgc       120
     ctacatactt ttgtggaggt gacgatggtg acaggtgttt tcgcagcgct cggctttgtt       180
     gttaaagagc ttgtcttttt agtatcttac gtgaaaaaca atgcctttcc acaaccgctc       240
     tcaagcagcg aagaaaaaaa atacttagag ctcatggcta aaggggatga acatgccaga       300
     aacatgctga ttgagcataa tcttcgcttg gtcgcccata ttgtgaaaaa gttcgaaaat       360
     acaggtgagg atgcagagga cttaatctcc atcggaacga tcgggcttat taaaggaatt       420
     gaaagctatt ccgctggaaa agggacaaag ctggcgacgt atgcagcgag gtgtattgaa       480
     aatgagattg taattacaaa aggggggtgc atacacccct ctttaatacg tttcaatata       540
     tatggtgtca gaatccacaa tggtaacttc tttcacgata aagttaacaa ttgttttttt       600
     atcttcaaga gttaagttat ctgcaccgat tgattgaaaa tagtcgatgg ctctttttag       660
     agcattttca cttgagctc                                                    679
//

If you have problems or comments...

PBIL Back to PBIL home page