(data stored in SCRATCH zone)

EMBL: AH002677

ID   AH002677; SV 2; linear; genomic DNA; STD; HUM; 5150 BP.
XX
AC   AH002677; M26605-M26628;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens enkephalinase (MME) gene, complete cds.
XX
KW   common acute lymphoblastic leukemia antigen; integral membrane protein;
KW   neutral endopeptidase.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5150
RX   DOI; 10.1073/pnas.86.18.7103.
RX   PUBMED; 2528730.
RA   D'Adamio L., Shipp M.A., Masteller E.L., Reinherz E.L.;
RT   "Organization of the gene encoding common acute lymphoblastic leukemia
RT   antigen (neutral endopeptidase 24.11): multiple miniexons and separate 5'
RT   untranslated regions";
RL   Proc. Natl. Acad. Sci. U.S.A. 86(18):7103-7107(1989).
XX
DR   MD5; ff33bc543d284ef1f62950785c41b151.
XX
CC   On or before Jun 10, 2016 this sequence version replaced gi:179835,
CC   gi:179836, gi:179837, gi:179838, gi:179839, gi:179840, gi:179841,
CC   gi:179842, gi:179843, gi:179844, gi:179845, gi:179846, gi:179847,
CC   gi:179848, gi:179849, gi:179850, gi:179851, gi:179852, gi:179853,
CC   gi:179854, gi:179855, gi:179856, gi:179857, gi:179858, gi:179859.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5150
FT                   /organism="Homo sapiens"
FT                   /map="3q21-q27"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="NALM 6"
FT                   /db_xref="taxon:9606"
FT   gene            1..5136
FT                   /gene="MME"
FT   exon            <1..87
FT                   /gene="MME"
FT                   /number=1
FT                   /note="G00-120-190"
FT   intron          88..>92
FT                   /gene="MME"
FT                   /number=1
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             93..192
FT                   /estimated_length=unknown
FT   exon            193..409
FT                   /gene="MME"
FT                   /number=2
FT                   /note="alternative exon; G00-120-190"
FT   exon            193..222
FT                   /gene="MME"
FT                   /number=2
FT                   /note="alternative exon; G00-120-190"
FT   intron          223..>414
FT                   /gene="MME"
FT                   /number=2
FT                   /note="CALLA/NEP alternative intron; G00-120-190"
FT   intron          410..>414
FT                   /gene="MME"
FT                   /number=2
FT                   /note="CALLA/NEP alternative intron; G00-120-190"
FT   gap             415..514
FT                   /estimated_length=unknown
FT   intron          <515..521
FT                   /gene="MME"
FT                   /number=2
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            522..691
FT                   /gene="MME"
FT                   /number=3
FT                   /note="G00-120-190"
FT   CDS_pept        join(532..691,804..839,952..1113,1226..1306,1419..1514,
FT                   1627..1745,1858..1923,2036..2170,2283..2384,2497..2633,
FT                   2746..2839,2952..3080,3193..3291,3404..3484,3597..3700,
FT                   3813..3871,3984..4103,4216..4349,4462..4527,4640..4735,
FT                   4848..4924,5037..5136)
FT                   /codon_start=1
FT                   /gene="MME"
FT                   /product="enkephalinase"
FT                   /EC_number="3.4.24.11"
FT                   /note="common acute lymphoblastic antigen"
FT                   /protein_id="AAA52294.1"
FT                   /translation="MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTM
FT                   IALYATYDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRY
FT                   GNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPD
FT                   IYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQP
FT                   RLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEK
FT                   EIANATAKPEDRNDPMLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITN
FT                   EEDVVVYAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALY
FT                   GTTSETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDL
FT                   TWMDAETKKRAEEKALAIKERIGYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKF
FT                   SQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYG
FT                   GIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAG
FT                   GQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVW
FT                   CGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW"
FT   intron          692..>696
FT                   /gene="MME"
FT                   /number=3
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             697..796
FT                   /estimated_length=unknown
FT   intron          <797..803
FT                   /gene="MME"
FT                   /number=3
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            804..839
FT                   /gene="MME"
FT                   /number=4
FT                   /note="G00-120-190"
FT   intron          840..>844
FT                   /gene="MME"
FT                   /number=4
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             845..944
FT                   /estimated_length=unknown
FT   intron          <945..951
FT                   /gene="MME"
FT                   /number=4
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            952..1113
FT                   /gene="MME"
FT                   /number=5
FT                   /note="G00-120-190"
FT   intron          1114..>1118
FT                   /gene="MME"
FT                   /number=5
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             1119..1218
FT                   /estimated_length=unknown
FT   intron          <1219..1225
FT                   /gene="MME"
FT                   /number=5
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            1226..1306
FT                   /gene="MME"
FT                   /number=6
FT                   /note="G00-120-190"
FT   intron          1307..>1311
FT                   /gene="MME"
FT                   /number=6
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             1312..1411
FT                   /estimated_length=unknown
FT   intron          <1412..1418
FT                   /gene="MME"
FT                   /number=6
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            1419..1514
FT                   /gene="MME"
FT                   /number=7
FT                   /note="G00-120-190"
FT   intron          1515..>1519
FT                   /gene="MME"
FT                   /number=7
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             1520..1619
FT                   /estimated_length=unknown
FT   intron          <1620..1626
FT                   /gene="MME"
FT                   /number=7
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            1627..1745
FT                   /gene="MME"
FT                   /number=8
FT                   /note="G00-120-190"
FT   intron          1746..>1750
FT                   /gene="MME"
FT                   /number=8
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             1751..1850
FT                   /estimated_length=unknown
FT   intron          <1851..1857
FT                   /gene="MME"
FT                   /number=8
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            1858..1923
FT                   /gene="MME"
FT                   /note="G00-120-190"
FT   intron          1924..>1928
FT                   /gene="MME"
FT                   /number=9
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             1929..2028
FT                   /estimated_length=unknown
FT   intron          <2029..2035
FT                   /gene="MME"
FT                   /number=9
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            2036..2170
FT                   /gene="MME"
FT                   /number=10
FT                   /note="G00-120-190"
FT   intron          2171..>2175
FT                   /gene="MME"
FT                   /number=10
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             2176..2275
FT                   /estimated_length=unknown
FT   intron          <2276..2282
FT                   /gene="MME"
FT                   /number=10
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            2283..2384
FT                   /gene="MME"
FT                   /number=11
FT                   /note="G00-120-190"
FT   intron          2385..>2389
FT                   /gene="MME"
FT                   /number=11
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             2390..2489
FT                   /estimated_length=unknown
FT   intron          <2490..2496
FT                   /gene="MME"
FT                   /number=11
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            2497..2633
FT                   /gene="MME"
FT                   /number=12
FT                   /note="G00-120-190"
FT   intron          2634..>2638
FT                   /gene="MME"
FT                   /number=12
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             2639..2738
FT                   /estimated_length=unknown
FT   intron          <2739..2745
FT                   /gene="MME"
FT                   /number=12
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            2746..2839
FT                   /gene="MME"
FT                   /number=13
FT                   /note="G00-120-190"
FT   intron          2840..>2844
FT                   /gene="MME"
FT                   /number=13
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             2845..2944
FT                   /estimated_length=unknown
FT   intron          <2945..2951
FT                   /gene="MME"
FT                   /number=13
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            2952..3080
FT                   /gene="MME"
FT                   /number=14
FT                   /note="G00-120-190"
FT   intron          3081..>3085
FT                   /gene="MME"
FT                   /number=14
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             3086..3185
FT                   /estimated_length=unknown
FT   intron          <3186..3192
FT                   /gene="MME"
FT                   /number=14
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            3193..3291
FT                   /gene="MME"
FT                   /number=15
FT                   /note="G00-120-190"
FT   intron          3292..>3296
FT                   /gene="MME"
FT                   /number=15
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             3297..3396
FT                   /estimated_length=unknown
FT   intron          <3397..3403
FT                   /gene="MME"
FT                   /number=15
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            3404..3484
FT                   /gene="MME"
FT                   /number=16
FT                   /note="G00-120-190"
FT   intron          3485..>3489
FT                   /gene="MME"
FT                   /number=16
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             3490..3589
FT                   /estimated_length=unknown
FT   intron          <3590..3596
FT                   /gene="MME"
FT                   /number=16
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            3597..3700
FT                   /gene="MME"
FT                   /number=17
FT                   /note="G00-120-190"
FT   intron          3701..>3705
FT                   /gene="MME"
FT                   /number=17
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             3706..3805
FT                   /estimated_length=unknown
FT   intron          <3806..3812
FT                   /gene="MME"
FT                   /number=17
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            3813..3871
FT                   /gene="MME"
FT                   /number=18
FT                   /note="G00-120-190"
FT   intron          3872..>3876
FT                   /gene="MME"
FT                   /number=18
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             3877..3976
FT                   /estimated_length=unknown
FT   intron          3977..3983
FT                   /gene="MME"
FT                   /number=18
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            3984..4103
FT                   /gene="MME"
FT                   /number=19
FT                   /note="G00-120-190"
FT   intron          4104..4108
FT                   /gene="MME"
FT                   /number=19
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             4109..4208
FT                   /estimated_length=unknown
FT   intron          <4209..4215
FT                   /gene="MME"
FT                   /number=19
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            4216..4349
FT                   /gene="MME"
FT                   /number=20
FT                   /note="G00-120-190"
FT   intron          4350..>4354
FT                   /gene="MME"
FT                   /number=20
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             4355..4454
FT                   /estimated_length=unknown
FT   intron          <4455..4461
FT                   /gene="MME"
FT                   /number=20
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            4462..4527
FT                   /gene="MME"
FT                   /number=21
FT                   /note="G00-120-190"
FT   intron          4528..>4532
FT                   /gene="MME"
FT                   /number=21
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             4533..4632
FT                   /estimated_length=unknown
FT   intron          <4633..4639
FT                   /gene="MME"
FT                   /number=21
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            4640..4735
FT                   /gene="MME"
FT                   /number=22
FT                   /note="G00-120-190"
FT   intron          4736..>4740
FT                   /gene="MME"
FT                   /number=22
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             4741..4840
FT                   /estimated_length=unknown
FT   intron          <4841..4847
FT                   /gene="MME"
FT                   /number=22
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            4848..4924
FT                   /gene="MME"
FT                   /number=23
FT                   /note="G00-120-190"
FT   intron          4925..>4929
FT                   /gene="MME"
FT                   /number=23
FT                   /note="CALLA/NEP; G00-120-190"
FT   gap             4930..5029
FT                   /estimated_length=unknown
FT   intron          <5030..5036
FT                   /gene="MME"
FT                   /number=23
FT                   /note="CALLA/NEP; G00-120-190"
FT   exon            5037..>5136
FT                   /gene="MME"
FT                   /number=24
FT                   /note="G00-120-190"
XX
SQ   Sequence 5150 BP; 882 A; 536 C; 669 G; 763 T; 2300 other;
     gcggagatgt gcaagtggcg aagcttgacc gagagcaggc tggagcagcc gcccaactcc        60
     tggcgcggga tctgctgagg ggtcacggtg agnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nncctggagg agggctctgg aagtcacgtc aggttggctc ttcaggttca       240
     tttccatagt tccctgcggc ctctgccttg gggagttatg ttttgttacc gagatccgcg       300
     ctaccagatt gcaccggggc tgatttgggg gctgggaatt tgccattctg ctgtacagac       360
     actgattttt ttttcttctt tttaaaaagc aaggtttgtt ttcattttgg tttcnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnntttgca gattttaggt gatgggcaag       540
     tcagaaagtc agatggatat aactgatatc aacactccaa agccaaagaa gaaacagcga       600
     tggactccac tggagatcag cctctcggtc cttgtcctgc tcctcaccat catagctgtg       660
     acaatgatcg cactctatgc aacctacgat ggtgagnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       780
     nnnnnnnnnn nnnnnntttc tagatggtat ttgcaagtca tcagactgca taaaatcagg       840
     taagnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnncttgca gctgctcgac       960
     tgatccaaaa catggatgcc accactgagc cttgtacaga ctttttcaaa tatgcttgcg      1020
     gaggctggtt gaaacgtaat gtcattcccg agaccagctc ccgttacggc aactttgaca      1080
     ttttaagaga tgaactagaa gtcgttttga aaggttagnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnat ttcagatgtc cttcaagaac ccaaaactga agatatagta      1260
     gcagtgcaga aagcaaaagc attgtacagg tcttgtataa atgaatgtaa gnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nccaaaagct gctattgata gcagaggtgg      1440
     agaacctcta ctcaaactgt taccagacat atatgggtgg ccagtagcaa cagaaaactg      1500
     ggagcaaaaa tatggtaagn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnng      1620
     ctttaggtgc ttcttggaca gctgaaaaag ctattgcaca actgaattct aaatatggga      1680
     aaaaagtcct tattaatttg tttgttggca ctgatgataa gaattctgtg aatcatgtaa      1740
     ttcatgtaag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1800
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn tttatagatt      1860
     gaccaacctc gacttggcct cccttctaga gattactatg aatgcactgg aatctataaa      1920
     gaggtaaann nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1980
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnct tgcaggcttg      2040
     tacagcatat gtggatttta tgatttctgt ggccagattg attcgtcagg aagaaagatt      2100
     gcccatcgat gaaaaccagc ttgctttgga aatgaataaa gttatggaat tggaaaaaga      2160
     aattgccaat gtaaannnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2220
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnntccat      2280
     aggctacggc taaacctgaa gatcgaaatg atccaatgct tctgtataac aagatgacat      2340
     tggcccagat ccaaaataac ttttcactag agatcaatgg gaaggtaagn nnnnnnnnnn      2400
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2460
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnt ttccagccat tcagctggtt gaatttcaca      2520
     aatgaaatca tgtcaactgt gaatattagt attacaaatg aggaagatgt ggttgtttat      2580
     gctccagaat atttaaccaa acttaagccc attcttacca aatattctgc caggtaggnn      2640
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2700
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnta tacagagatc ttcaaaattt      2760
     aatgtcctgg agattcataa tggatcttgt aagcagcctc agccgaacct acaaggagtc      2820
     cagaaatgct ttccgcaagg tgaannnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2880
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2940
     nnnntccgta ggccctttat ggtacaacct cagaaacagc aacttggaga cgttgtgcaa      3000
     actatgtcaa tgggaatatg gaaaatgctg tggggaggct ttatgtggaa gcagcatttg      3060
     ctggagagag taaacatgtg gtaatnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3180
     nnnnnatttg aggtcgagga tttgattgca cagatccgag aagtttttat tcagacttta      3240
     gatgacctca cttggatgga tgccgagaca aaaaagagag ctgaagaaaa ggtaaannnn      3300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnttca taggccttag caattaaaga      3420
     aaggatcggc tatcctgatg acattgtttc aaatgataac aaactgaata atgagtacct      3480
     cgaggtaagn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnna atacagttga      3600
     actacaaaga agatgaatac ttcgagaaca taattcaaaa tttgaaattc agccaaagta      3660
     aacaactgaa gaagctccga gaaaaggtgg acaaagatga gtgcgnnnnn nnnnnnnnnn      3720
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3780
     nnnnnnnnnn nnnnnnnnnn nnnnntctac aggtggataa gtggagcagc tgtagtcaat      3840
     gcattttact cttcaggaag aaatcagata ggtaagnnnn nnnnnnnnnn nnnnnnnnnn      3900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3960
     nnnnnnnnnn nnnnnncttg tagtcttccc agccggcatt ctgcagcccc ccttctttag      4020
     tgcccagcag tccaactcat tgaactatgg gggcatcggc atggtcatag gacacgaaat      4080
     cacccatggc ttcgatgaca atggtaaann nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4200
     nnnnnnnntt ataaggcaga aactttaaca aagatggaga cctcgttgac tggtggactc      4260
     aacagtctgc aagtaacttt aaggagcaat cccagtgcat ggtgtatcag tatggaaact      4320
     tttcctggga cctggcaggt ggacagcacg tatgnnnnnn nnnnnnnnnn nnnnnnnnnn      4380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4440
     nnnnnnnnnn nnnnttaaca gcttaatgga attaatacac tgggagaaaa cattgctgat      4500
     aatggaggtc ttggtcaagc atacagagta agnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4620
     nnnnnnnnnn nntgcctagg cctatcagaa ttatattaaa aagaatggcg aagaaaaatt      4680
     acttcctgga cttgacctaa atcacaaaca actatttttc ttgaactttg cacaggtatt      4740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4800
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn tctctaggtg tggtgtggaa      4860
     cctataggcc agagtatgcg gttaactcca ttaaaacaga tgtgcacagt ccaggcaatt      4920
     tcaggtgctn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4980
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnt tcaaaggatt      5040
     attgggactt tgcagaactc tgcagagttt tcagaagcct ttcactgccg caagaattca      5100
     tacatgaatc cagaaaagaa gtgccgggtt tggtgatctt caaaagaagc                 5150
//

If you have problems or comments...

PBIL Back to PBIL home page