(data stored in SCRATCH zone)

EMBL: M26948

ID   M26948; SV 1; linear; genomic DNA; STD; PRO; 2360 BP.
XX
AC   M26948;
XX
DT   23-NOV-1989 (Rel. 21, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   B.subtilis flagellin gene (hag), complete cds.
XX
KW   flagellar filament protein; flagellin; H-antigen; motility protein.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-2360
RX   PUBMED; 2498284.
RA   Mirel D.B., Chamberlin M.J.;
RT   "The Bacillus subtilis flagellin gene (hag) is transcribed by the sigma 28
RT   form of RNA polymerase";
RL   J. Bacteriol. 171(6):3095-3101(1989).
XX
DR   MD5; 9da7a9085566a1fa78c9d545c1e9f068.
DR   GOA; P33911.
DR   InterPro; IPR003751; CsrA.
DR   InterPro; IPR005186; FlaG.
DR   InterPro; IPR035924; FlaG-like_sf.
DR   InterPro; IPR036107; CsrA_sf.
DR   PDB; 1T3O; NMR.
DR   PDB; 2HC5; NMR.
DR   UniProtKB/Swiss-Prot; P33911; CSRA_BACSU.
DR   UniProtKB/Swiss-Prot; P39737; YVYC_BACSU.
XX
CC   Draft entry and computer-readable copy of sequence [1] kindly
CC   provided by D.B.Mirel, 21-AUG-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2360
FT                   /organism="Bacillus subtilis"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   regulatory      420..423
FT                   /note="sigma D promoter -35 consensus; putative"
FT                   /regulatory_class="other"
FT   regulatory      439..446
FT                   /note="sigma D promoter -10 consensus; putative"
FT                   /regulatory_class="other"
FT   regulatory      529..535
FT                   /note="ribosome binding site (put.); putative"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        545..1459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="flagellin"
FT                   /db_xref="GOA:P02968"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="PDB:5MAW"
FT                   /db_xref="PDB:5WJT"
FT                   /db_xref="PDB:6GOW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02968"
FT                   /protein_id="AAA22509.1"
FT                   /translation="MRINHNIAALNTLNRLSSNNSASQKNMEKLSSGLRINRAGDDAAG
FT                   LAISEKMRGQIRGLEMASKNSQDGISLIQTAEGALTETHAILQRVRELVVQAGNTGTQD
FT                   KATDLQSIQDEISALTDEIDGISNRTEFNGKKLLDGTYKVDTATPANQKNLVFQIGANA
FT                   TQQISVNIEDMGADALGIKEADGSIAALHSVNDLDVTKFADNAADTADIGFDAQLKVVD
FT                   EAINQVSSQRAKLGAVQNRLEHTINNLSASGENLTAAESRIRDVDMAKEMSEFTKNNIL
FT                   SQASQAMLAQANQQPQNVLQLLR"
FT   regulatory      1634..1637
FT                   /note="sigma D promoter -35 consensus; putative"
FT                   /regulatory_class="other"
FT   regulatory      1652..1659
FT                   /note="sigma D promoter -10 consensus; putative"
FT                   /regulatory_class="other"
XX
SQ   Sequence 2360 BP; 798 A; 438 C; 493 G; 631 T; 0 other;
     atcgataata ttcaagacgt agaagtcatg acaatattga ctatggcaga gcatttgaaa        60
     agtctactgc gaatttattg gctcccatta ttgtgaatcg caagaacatg atggctaagc       120
     aagtcgtttt acacgactcc tcatatacga caaagcatcc gattggagga gaatcatgct       180
     agttttatcg cggaaaataa acgaagcgat tcaaataggt gctgatattg aagtaaaagt       240
     gattgcggtt gaaggggatc aagtgaagct tggaattgac gccccaaagc atattgatat       300
     tcacaggaaa gaaatttact tgaccattca ggaagaaaat aaccgtgcag cagcgttatc       360
     cagcgatgtg atctccgcat tatcctcaca aaaaaagtga ggattttttt atttttgtat       420
     taacaaaatc agagacaatc cgatattaat gatgtagccg ggaggaggcg caaaagactc       480
     agccagttac aaaataaggg cacaaggacg tgccttaaca acatattcag ggaggaacaa       540
     aacaatgaga attaaccaca atattgcagc gcttaacaca ctgaaccgtt tgtcttcaaa       600
     caacagtgcg agccaaaaga acatggagaa actttcttca ggtcttcgca tcaaccgtgc       660
     gggagatgac gcagcaggtc ttgcgatctc tgaaaaaatg agaggacaaa tcagaggtct       720
     tgaaatggct tctaaaaact ctcaagacgg aatctctctt atccaaacag ctgagggtgc       780
     attaactgaa actcatgcga tccttcaacg tgttcgtgag ctagttgttc aagctggaaa       840
     cactggaact caggacaaag caactgattt gcaatctatt caagatgaaa tttcagcttt       900
     aacagatgaa atcgatggta tttcaaatcg tacagaattc aatggtaaga aattgctcga       960
     tggcacttac aaagttgaca cagctactcc tgcaaatcaa aagaacttgg tattccaaat      1020
     cggagcaaat gctacacagc aaatctctgt aaatattgag gatatgggtg ctgacgctct      1080
     tggaattaaa gaagctgatg gttcaattgc agctcttcat tcagttaatg atcttgacgt      1140
     aacaaaattc gcagataatg cagcagatac tgctgatatc ggtttcgatg ctcaattgaa      1200
     agttgttgat gaagcgatca accaagtttc ttctcaacgt gctaagcttg gtgcggtaca      1260
     aaatcgtcta gagcacacaa ttaacaactt aagcgcttct ggtgaaaact tgacagctgc      1320
     tgagtctcgt atccgtgacg ttgacatggc taaagagatg agcgaattca caaagaacaa      1380
     cattctttct caggcttctc aagctatgct tgctcaagca aaccaacagc cgcaaaacgt      1440
     acttcaatta ttacgttaat tttaaaaaag accttggcgt tgccagggtc ttttaattta      1500
     aatttctatc tcctaatcat tcctcatcct gtcactaact catgatataa taaccggatt      1560
     ctccactaac tttttataaa tgtatttcca tacaagaaat ctaaaacaga agattttttt      1620
     ccaaaaatat gtgtaatctt atctcgactt agtcgatata aacgatagat tggggcatag      1680
     gggatgatca attgaacatt gaaaggctca ctacgttaca acctgtttgg gatcgttatg      1740
     atactcaaat acataatcag aaagataatg ataacgaggt tcctgttcat caagtttcat      1800
     ataccaatct tgctgaaatg gtgggggaaa tgaacaagct tttggaacct tcgcaagttc      1860
     atctgaagtt cgagcttcat gacaagttaa atgaatacta tgtaaaggta atagaggact      1920
     ctacaaatga agtgatccgc gaaattccac caaaacggtg gcttgatttt tatgcggcta      1980
     tgactgaatt tcttgggtta tttgtagatg aaaaaaagta gaataggagt ggtttgagat      2040
     ggtcacaaga ataacaggtc tggcgtcagg aatggatata gatgatatcg tatcaaagct      2100
     gatgcagaca gaaagagcgc cgcttgataa gctgacacaa aaaaagcaga ctcttgaatg      2160
     gcagcgtgac agctatcgtg aagtaaactc aaaaataaaa gaattgcaag attatatgtc      2220
     taaaaatacg ttgacatatc cgagcacgta tcagagcaaa actgtgacaa gctctaatga      2280
     gtctgtgtta actgctacag gaagcgtaag tgcgccaaat tcttcgtcta ctgttgaagt      2340
     ggcgagcttg gcaactgcag                                                  2360
//

If you have problems or comments...

PBIL Back to PBIL home page