(data stored in SCRATCH zone)

EMBL: M27259

ID   M27259; SV 1; linear; genomic DNA; STD; PRO; 1053 BP.
XX
AC   M27259;
XX
DT   31-JAN-1990 (Rel. 22, Created)
DT   23-FEB-2000 (Rel. 62, Last updated, Version 3)
XX
DE   B.subtilis gerD gene, complete cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-1053
RX   PUBMED; 2517635.
RA   Yon J.R., Sammons R.L., Smith D.A.;
RT   "Cloning and sequencing of the gerD gene of Bacillus subtilis";
RL   J. Gen. Microbiol. 135(12):3431-3445(1989).
XX
DR   MD5; 411dcd0094b2e1c5ee96393121d52ce5.
DR   GOA; P50863.
DR   InterPro; IPR000808; Mrp_CS.
DR   InterPro; IPR019591; Mrp/NBP35_ATP-bd.
DR   InterPro; IPR027417; P-loop_NTPase.
DR   InterPro; IPR033756; YlxH/NBP35.
DR   UniProtKB/Swiss-Prot; P50863; APBC_BACSU.
XX
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by R.L.Sammons, 17-AUG-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1053
FT                   /organism="Bacillus subtilis"
FT                   /strain="W168"
FT                   /sub_strain="PY79"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        complement(<1..285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="unknown ORF"
FT                   /db_xref="GOA:P16449"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16449"
FT                   /protein_id="AAA22469.2"
FT                   /translation="MNKEMKSRGLVRFFFSILAVGALITSIVGFALKWGEYRGLFLTFE
FT                   AGQIFSVLFWFIGVGMIFSVISQMGFFVFLTVHRFALEILRSSSLWNLLQ"
FT   regulatory      complement(284..291)
FT                   /note="ribosome binding site"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      320..325
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      complement(339..344)
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      complement(363..368)
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      366..373
FT                   /note="ribosome binding site"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        381..938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="gerD protein"
FT                   /db_xref="GOA:P16450"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16450"
FT                   /protein_id="AAA22470.1"
FT                   /translation="MSKAKTLLMSCFLLLSVTACAPKDQAADMDYDQTKKMVVDILKTD
FT                   DGKKAIKELLNDDAMNEALVIDQDAIKGTIEKTLTSKKGEEFWKNIFEDTDFAEGFAKT
FT                   LQTEHEKVIKKLMKDPDYQKMLMSVMQDPGMDKKYSQLAKSQEFRSYLEEVINETLSSP
FT                   LYKKQFEDELKKAAKDTAKESE"
FT   repeat_region   947..965
FT                   /note="region of dyad symmetry"
XX
SQ   Sequence 1053 BP; 397 A; 199 C; 198 G; 259 T; 0 other;
     ctgcagcaaa ttccacaaag aggaggacct taatatctca agcgcaaacc gatgaactgt        60
     taaaaacacg aaaaaaccca tttggctgat cacactgaaa atcatgccta caccgataaa       120
     ccaaaataaa acagagaaaa tctgtcccgc ttcaaatgtt agaaacagcc ctctatattc       180
     tccccacttt aaagcaaaac ccacaatact cgtgataagc gccccgacag ctaaaataga       240
     aaagaaaaaa cgaactaaac cacggctttt catttcttta ttcatcccct caaaaatcgc       300
     gaacagctat tttgttatgt ataattccaa acagatgaat catattaaag gtaagacaag       360
     tatgtgaaag gagcttaagc atgtcaaaag ccaaaacgct attgatgagc tgttttttgt       420
     tattatctgt aacagcttgc gctccaaaag accaagcagc ggatatggac tatgatcaga       480
     ccaaaaaaat ggttgttgat atattaaaaa ctgatgatgg aaagaaagct attaaggaat       540
     tattaaatga tgatgccatg aatgaagcgc tggtgattga ccaagatgca attaaaggaa       600
     caatagaaaa aacactcaca tctaaaaaag gtgaagaatt ttggaaaaac atctttgaag       660
     acactgattt tgctgagggc tttgccaaaa ctcttcagac agagcatgaa aaagtgatta       720
     aaaagctgat gaaggatcca gattaccaga agatgctgat gagcgttatg caggatcccg       780
     gcatggataa aaagtacagc cagctggcaa aaagccaaga attccgcagt tatttagaag       840
     aggttattaa cgaaacactt tctagtccgc tttacaaaaa gcagttcgaa gatgagctga       900
     aaaaagcagc aaaagacaca gcaaaagaaa gtgaataaag ggaaagccgg gatctggaat       960
     cccggttcac cttttatacc tgcactgaca tttttgcatc tatttttttt gcgatgtcct      1020
     gatatatttc tccgattgga tgattttcgt ata                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page