(data stored in SCRATCH zone)

EMBL: M27869

ID   M27869; SV 1; linear; genomic DNA; STD; PRO; 1153 BP.
XX
AC   M27869;
XX
DT   02-FEB-1990 (Rel. 22, Created)
DT   09-SEP-2004 (Rel. 81, Last updated, Version 4)
XX
DE   B.subtilis ahrC gene, encoding an arginine repressor/activator protein.
XX
KW   arginine activator; arginine regulatory protein; arginine repressor.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-1153
RX   DOI; 10.1016/0378-1119(89)90247-3.
RX   PUBMED; 2507400.
RA   North A.K., Smith M.C.M., Baumberg S.;
RT   "Nucleotide sequence of a Bacillus subtilis arginine regulatory gene and
RT   homology of its product to the Escherichia coli arginine repressor";
RL   Gene 80(1):29-38(1989).
XX
DR   MD5; 7c87b0a472617c897591cd7e63b9b368.
XX
CC   Draft entry and computer-readable copy of sequence [1] kindly
CC   provided by S.Baumberg, 06-NOV-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1153
FT                   /organism="Bacillus subtilis"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        <1..198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="unidentified ORF1"
FT                   /db_xref="GOA:P19672"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19672"
FT                   /protein_id="AAA22207.1"
FT                   /translation="CMLIAQRMISFSAAEGYICKGLSFSPITGGDGNIEFLLQFALAGR
FT                   GTGRPGTAGRRDHARCRRST"
FT   repeat_region   229..252
FT                   /note="inverted repeat"
FT   regulatory      318..327
FT                   /note="ribosome binding site"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        333..782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="ahrC protein"
FT                   /db_xref="GOA:P17893"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:1F9N"
FT                   /db_xref="PDB:2P5K"
FT                   /db_xref="PDB:2P5L"
FT                   /db_xref="PDB:2P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17893"
FT                   /protein_id="AAA22208.1"
FT                   /translation="MNKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDI
FT                   KELHLVKVPTNNGSYKYSLPADQRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQ
FT                   AIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL"
FT   regulatory      800..809
FT                   /note="ribosome binding site"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        819..>1153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="unidentified ORF2 (ttg start codon)"
FT                   /db_xref="GOA:P17894"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17894"
FT                   /protein_id="AAA22209.1"
FT                   /translation="MLAELSIKNFAIIEELTVSFERGLTVLTGETGAGKSIIIDAISLL
FT                   VGGRGSSEFVRYGEAKAELEGLFLLESGLPVLGVCAEQGIDVSDEMIVMRRDISTSGKA
FT                   FAVSMAS"
XX
SQ   Sequence 1153 BP; 361 A; 211 C; 299 G; 282 T; 0 other;
     tgcatgctga ttgctcagcg aatgatcagt ttttctgccg ctgaaggcta tatctgtaaa        60
     ggcttgtcat tttctccaat cacgggagga gacggaaata ttgagtttct ccttcagttt       120
     gcattggccg ggagagggac aggaaggcca ggaactgccg gaagaagaga tcatgcgcgt       180
     tgtagaagaa gcacataaga cgttaaaaga aaaaaaagca gatgtaccgg aataataggg       240
     cgctattatt ccttttttct gcattcatgt acaatgtgca gagaatcata taacataaaa       300
     gaacagataa gcttggaaat agaggtgctt acatgaacaa aggccagagg catattaaaa       360
     tcagagagat cattacaagc aatgaaatcg aaacgcagga tgaattggtc gacatgctaa       420
     agcaggatgg atacaaagta acgcaggcca cggtatcacg ggatattaaa gaacttcacc       480
     ttgtaaaagt gcctacaaat aatggttctt acaaatacag tcttccggcg gaccagcgtt       540
     tcaatccgct gtcaaagcta aagcgggcat tgatggacgc atttgtgaaa atagactcag       600
     caagccatat gattgtgctg aaaacgatgc cgggcaatgc ccaggcaatc ggggcgctga       660
     tggacaattt ggactgggat gaaatgatgg ggaccatttg cggagatgat acgattttaa       720
     ttatttgccg gactcctgaa gatacagaag gcgtaaaaaa caggctcctt gaactgctgt       780
     aacagaaaat ctaacaaaga taagaggtgt aatgctgttt gttagctgaa ctatcgatta       840
     aaaactttgc cattattgag gaactgacgg tttcttttga acgcgggctt acggttttaa       900
     caggagaaac cggagccggc aaatccatca tcatagatgc catttctctt ttagtcggag       960
     gccgcggatc atctgaattt gttagatatg gggaagcaaa agccgaactt gaagggctgt      1020
     ttctgttgga gagcggccta cctgttttag gcgtatgcgc tgagcaggga atcgacgttt      1080
     cagacgaaat gatcgtcatg agaagggata tcagcacgag cggaaaagcg tttgccgtgt      1140
     caatggcaag ctt                                                         1153
//

If you have problems or comments...

PBIL Back to PBIL home page