(data stored in SCRATCH zone)

EMBL: M29040

ID   M29040; SV 1; linear; genomic DNA; STD; PRO; 2246 BP.
XX
AC   M29040;
XX
DT   19-APR-1990 (Rel. 23, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   B.subtilis site-specific DNA recombinase (cisA) and RNA polymerase sigma-K
DE   subunit (cisB; spoIVCB) genes, complete cds.
XX
KW   DNA recombinase; RNA polymerase sigma-K subunit.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-2246
RX   PUBMED; 2105293.
RA   Sato T., Samori Y., Kobayashi Y.;
RT   "The cisA cistron of Bacillus subtilis sporulation gene spoIVC encodes a
RT   protein homologous to a site-specific recombinase";
RL   J. Bacteriol. 172(2):1092-1098(1990).
XX
DR   MD5; 51f6153ce0d17fbd517dfb882a33d716.
DR   EuropePMC; PMC90116; 10952626.
DR   GOA; P42983.
DR   InterPro; IPR029476; DNase_NucA_NucB.
DR   UniProtKB/Swiss-Prot; P42983; NUCB_BACSU.
XX
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by Y.Kobayashi, 14-OCT-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2246
FT                   /organism="Bacillus subtilis"
FT                   /strain="W168"
FT                   /sub_strain="PY79"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   regulatory      119..127
FT                   /note="ribosome binding site"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        134..1636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="DNA recombinase (cisA) (gtg start codon)"
FT                   /db_xref="GOA:P17867"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17867"
FT                   /protein_id="AAA22314.1"
FT                   /translation="MIAIYVRVSTEEQAIKGSSIDSQIEACIKKAGTKDVLKYADEGFS
FT                   GELLERPALNRLREDASKGLISQVICYDPDRLSRKLMNQLIIDDELRKRNIPLIFVNGE
FT                   YANSPEGQLFFAMRGAISEFEKAKIKERTSSGRLQKMKKGMIIKDSKLYGYKFVKEKRT
FT                   LEILEEEAKIIRMIFNYFTDHKSPFFGRVNGIALHLTQMGVKTKKGAKVWHRQVVRQIL
FT                   MNSSYKGEHRQYKYDTEGSYVSKQAGNKSIIKIRPEEEQITVTIPAIVPAEQWDYAQEL
FT                   LGQSKRKHLSISPHNYLLSGLVRCGKCGNTMTGKKRKSHGKDYYVYTCRKNYSGAKDRG
FT                   CGKEMSENKLNRHVWGEIFKFITNPQKYVSFKEAEQSNHLSDELELIEKEIEKTKKGRK
FT                   RLLTLISLSDDDDLDIDEIKAQIIELQKKQNQLTEKCNRIQSKMKVLDDTSSSENALKR
FT                   AIDYFQSIGADNLTLEDKKTIVNFIVKEVTIVDSDTIYIETY"
FT   CDS_pept        complement(1544..2014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="RNA polymerase sigma-K subunit (cisB)"
FT                   /db_xref="GOA:P12254"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12254"
FT                   /protein_id="AAA22315.1"
FT                   /translation="MVTGVFAALGFVVKELVFLVSYVKNNAFPQPLSSSEEKKYLELMA
FT                   KGDEHARNMLIEHNLRLVAHIVKKFENTGEDAEDLISIGTIGLIKGIESYSAGKGTKVA
FT                   TYAARCIENEIVITKGGCIHPSLIRFNIYGVRIHNGNFFHDKVNNCFFIFKS"
FT   regulatory      1635..1660
FT                   /note="pot. transcription termination signal; putative"
FT                   /regulatory_class="other"
XX
SQ   Sequence 2246 BP; 776 A; 405 C; 475 G; 590 T; 0 other;
     cagctgttac atagcattac ccaaggggtg atgcatttta tgaaagtgat aatcatcgag        60
     ggaccgcaag ctgacaaatg cattaacgat tgctatcatt atttaataaa actttatagg       120
     aaggagattc agggtgatag caatatatgt aagggtatcg accgaggaac aagcgatcaa       180
     gggatcgagc atcgacagcc aaatcgaggc ctgtataaag aaagcaggga ctaaagatgt       240
     gctgaagtat gcagatgaag gattttcagg agagctttta gaacgtccgg ctttgaatcg       300
     cttgagggag gatgcaagca agggacttat aagtcaagtc atttgttacg atcctgaccg       360
     tctttctcgg aaattaatga atcagctaat cattgatgac gaattgcgaa agcgaaacat       420
     acctttgatt tttgtaaatg gtgaatacgc caattctcca gaaggtcaat tgtttttcgc       480
     aatgcgcggg gcaatctcag aatttgaaaa agccaaaatc aaagaacgga catcaagcgg       540
     ccgacttcaa aaaatgaaaa aaggcatgat cattaaagat tctaaactat atggctataa       600
     atttgttaaa gagaaaagaa ctcttgagat attagaagag gaagcaaaaa tcattcggat       660
     gatttttaac tatttcaccg atcataaaag cccttttttc ggcagagtaa atggtattgc       720
     tctacattta actcagatgg gggttaaaac aaaaaaaggc gccaaagtat ggcacaggca       780
     ggttgttcgg caaatattaa tgaactcttc ctataagggt gaacatagac agtataaata       840
     tgatacagag ggttcctatg tttcaaagca ggcagggaac aaatctataa ttaaaataag       900
     gcctgaagaa gaacaaatca ctgtgacaat tccagcaatt gttccagctg aacaatggga       960
     ttatgctcaa gaactcttag gtcaaagtaa aagaaaacac ttgagtatca gccctcacaa      1020
     ttacttgtta tcgggtttgg ttagatgcgg aaaatgcgga aataccatga cagggaagaa      1080
     aagaaaatca catggtaaag actactatgt atatacttgc cggaaaaatt attctggcgc      1140
     aaaggaccgc ggctgcggaa aagaaatgtc tgagaataaa ttgaaccggc atgtatgggg      1200
     tgaaattttt aaattcatca caaatcctca aaagtatgtt tcttttaaag aggctgaaca      1260
     atcaaatcac ctgtctgatg aattagaact tattgaaaaa gagatagaga aaacaaaaaa      1320
     aggccgcaag cgtcttttaa cgctaatcag cctaagcgat gacgatgatt tagacataga      1380
     tgaaatcaaa gcacaaatta ttgaactgca aaaaaagcaa aatcagctta ctgaaaagtg      1440
     taacagaatc cagtcaaaaa tgaaagtcct agatgatacg agctcaagtg aaaatgctct      1500
     aaaaagagcc atcgactatt ttcaatcaat cggtgcagat aacttaactc ttgaagataa      1560
     aaaaacaatt gttaacttta tcgtgaaaga agttaccatt gtggattctg acaccatata      1620
     tattgaaacg tattaaagag gggtgtatgc accccccttt tgtaattaca atctcatttt      1680
     caatacacct cgctgcatac gtcgccacct ttgtcccttt tccagcggaa tagctttcaa      1740
     ttcctttaat aagcccgatc gttccgatgg agattaagtc ctctgcatcc tcacctgtat      1800
     tttcgaactt tttcacaata tgggcgacca agcgaagatt atgctcaatc agcatgtttc      1860
     tggcatgttc atccccttta gccatgagct ctaagtattt tttttcttcg ctgcttgaga      1920
     gcggttgtgg aaaggcattg tttttcacgt aagatactaa aaagacaagc tctttaacaa      1980
     caaagccgag cgctgcgaaa acacctgtca ccatcgtcac ctccacaaaa gtatgtaggc      2040
     aaaagcctat atgtaaatgt atgtgaccgg gaggctgtct gtgtctgtac cgggaaattt      2100
     ctcgcggggg agtccggctt tggtaagcag catactaact tcaaatgtta aaaatattct      2160
     tcatcaagcg cccatacatt gaaatgaaca aaggtatggg gggatgggga tgaaaaaatg      2220
     gatggcaggc ctgtttcttg ctgcag                                           2246
//

If you have problems or comments...

PBIL Back to PBIL home page