(data stored in SCRATCH zone)

EMBL: M30297

ID   M30297; SV 1; linear; genomic DNA; STD; PRO; 3360 BP.
XX
AC   M30297;
XX
DT   19-APR-1990 (Rel. 23, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   B.subtilis recombination and sporulation protein (recN, spoIVB) genes ,
DE   complete cds, arginine hydroximate resistance (ahrC) gene, 3' end.
XX
KW   arginine hydroximate resistance protein; recombination protein;
KW   sporulation protein.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-3360
RX   PUBMED; 2106508.
RA   Van Hoy B.E., Hoch J.A.;
RT   "Characterization of the spoIVB and recN loci of Bacillus subtilis";
RL   J. Bacteriol. 172(3):1306-1311(1990).
XX
DR   MD5; 7fa3a6c328abc9c75aefbfe62363ba86.
XX
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by J.A.Hoch, 30-NOV-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3360
FT                   /organism="Bacillus subtilis"
FT                   /strain="W168"
FT                   /sub_strain="PY79"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        <1..94
FT                   /codon_start=2
FT                   /transl_table=11
FT                   /note="arginine hydroximate resistance protein"
FT                   /db_xref="GOA:P17893"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:1F9N"
FT                   /db_xref="PDB:2P5K"
FT                   /db_xref="PDB:2P5L"
FT                   /db_xref="PDB:2P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17893"
FT                   /protein_id="AAA22690.1"
FT                   /translation="GTICGDDTILIICRTPEDTEGVKNRLLELL"
FT   misc_feature    62..98
FT                   /note="LexA boxes (put.); putative"
FT   CDS_pept        131..1861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="recombination protein (ttg start codon)"
FT                   /db_xref="GOA:P17894"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17894"
FT                   /protein_id="AAA22691.1"
FT                   /translation="MLAELSIKNFAIIEELTVSFERGLTVLTGETGAGKSIIIDAISLL
FT                   VGGRGSSEFVRYGEAKAELEGLFLLESGHPVLGVCAEQGIDVSDEMIVMRRDISTSGKS
FT                   VCRVNGKLVTIASLREIGRLLLDIHGQHDNQLLMEDENHLQLLDKFAGAEVESALKTYQ
FT                   EGYQRYVKLLKKLKQLSESEQEMAHCLDLIQFQLEEIESAKLELNEDEQLQEERQQISN
FT                   FEKIYESLQNAYNALRSEQGGLDWVGMASAQLEDISDINEPLKKMSESVSNSYYLLEDA
FT                   TFQMRNMLDELEFDPERLNYIETRLNEIKQLKRKYGATVEDILEYASKIEEEIDQIENR
FT                   DSHLQSLKKELDSVGKDVAVEAANVSQIRKTWAKKLADEIHRELKSLYMEKSTFDTEFK
FT                   VRTASRNEEAPLVNGQPVQLTEQGIDLVKFLISTNTGEPLKSLSKVASGGELSRVMLAI
FT                   KSIFSSQQDVTSIIFDEVDTGVSGRVAQAIAEKIHKVSIGSQVLCITHLPQVAAMADTH
FT                   LYIAKELKDGRTTTRVKPLSKQEKVAEIERSIAGVEVTDLTKRHAKELLKQADQVKTTG
FT                   "
FT   misc_feature    1859..1883
FT                   /note="recN protein terminator"
FT   CDS_pept        2036..3313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="sporulation protein IVB"
FT                   /db_xref="GOA:P17896"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008763"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR014219"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17896"
FT                   /protein_id="AAA22692.1"
FT                   /translation="MPDNIRKAVGLILLVSLLSVGLCKPLKEYLLIPTQMRVFETQTQA
FT                   IETSLSVNAQTSESSEAFTVKKDPHEIKVTGKKSGESELVYDLAGFPIKKTKVHVLPDL
FT                   KVIPGGQSIGVKLHSVGVLVGFHQINTSEGKKSPGETAGIEAGDIIIEMNGQKIEKMND
FT                   VAPFIQKAGKTGESLDLLIKRDKQKIKTKLIPEKDEGEGKYRIGLYIRDSAAGIGTMTF
FT                   YEPKTKKYGALGHVISDMDTKKPIVVENGEIVKSTVTSIEKGTGGNPGEKLARFSSERK
FT                   TIGDINRNSPFGIFGTLHQPIQNNISDQALPVAFSTEVKKGPAEILTVIDDDKVEKFDI
FT                   EIVSTTPQKFPATKGMVLKITDPRLLKETGGIVQGMSGSPIIQNGKVIGAVTHVFVNDP
FT                   TSGYGVHIEWMLSEAGIDIYGKEKAS"
FT   misc_feature    3317..3330
FT                   /note="sporulation protein terminator"
XX
SQ   Sequence 3360 BP; 1105 A; 634 C; 819 G; 802 T; 0 other;
     ggggaccatt tgcggagatg atacgatttt aattatttgc cggactcctg aagatacaga        60
     aggcgtaaaa aacaggctcc ttgaactgct gtaacagaaa atctaacaaa gataagaggt       120
     gtaatgctgt ttgttagctg aactatcgat taaaaacttt gccattattg aggaactgac       180
     ggtttctttt gaacgcgggc ttacggtttt aacaggagaa accggagccg gcaaatccat       240
     catcatagat gccatttctc ttttagtcgg aggccgcgga tcatctgaat ttgttagata       300
     tggggaagca aaagccgaac ttgaagggct gtttctgttg gagagcggcc atcctgtttt       360
     aggcgtatgc gctgagcagg gaatcgacgt ttcagacgaa atgatcgtca tgagaaggga       420
     tatcagcacg agcgggaaaa gcgtttgccg tgtcaatggc aagcttgtca cgattgcttc       480
     actaagagag atcggcaggc ttttattaga tattcacggg cagcacgata accagctgtt       540
     aatggaagac gaaaatcatc tccagctttt ggacaagttt gccggggccg aagtggaaag       600
     cgcgctcaaa acgtatcagg aagggtacca gcggtatgtg aagctgctca aaaagcttaa       660
     gcagctttct gaaagcgaac aggaaatggc ccattgtctt gatcttattc aatttcagct       720
     cgaagaaatc gaatcggcaa agcttgagct taacgaagat gaacagctcc aagaagagcg       780
     ccagcaaatt tcaaactttg agaagatata tgagtcgctg caaaatgcat ataacgcgct       840
     tcgcagtgag cagggcggat tggactgggt tggaatggca tcagcgcagc ttgaagatat       900
     atctgatata aacgaaccgc tgaaaaaaat gtctgaaagt gtttcgaact cctactattt       960
     gcttgaggat gccacatttc agatgagaaa tatgctggat gagcttgaat ttgatccgga      1020
     acgcctgaac tatattgaga cgcgacttaa tgaaatcaaa cagctgaaac gaaaatacgg      1080
     tgccactgtt gaagacattt tggaatatgc ttctaaaatt gaagaagaga ttgaccaaat      1140
     tgaaaacagg gacagccacc ttcaaagctt gaaaaaggag cttgactccg tcggcaaaga      1200
     tgtcgcagtg gaagcggcaa atgtgtcaca aatccgaaaa acatgggcga aaaagctggc      1260
     tgatgagatt catcgggaat taaaaagcct gtacatggaa aaatcaactt ttgatacgga      1320
     atttaaggtc agaacagcgt cacgcaatga agaggcgccg cttgtaaacg gccagcccgt      1380
     tcagctgact gaacaaggga ttgacctggt gaagttttta atttcaacca atacaggcga      1440
     gccgctgaaa tccctttcga aagtcgcttc aggtggagag ctgtcacggg tgatgcttgc      1500
     cataaaaagc attttttcct cacaacagga tgtgacatcg atcatttttg acgaggttga      1560
     taccggtgta agcggcaggg tcgcacaggc aattgctgag aagatccata aggtgtcaat      1620
     aggatcacaa gtgctgtgca ttacacacct gcctcaggtg gctgccatgg ccgatacgca      1680
     tctttatatt gcgaaggagt taaaagacgg cagaacgacg acacgtgtca agccgctctc      1740
     taagcaggaa aaggtagcgg aaatcgagcg cagtattgca ggtgtcgaag taaccgactt      1800
     aacgaaacgc catgcgaaag aacttttaaa acaagcggat caagtcaaaa caactgggta      1860
     agctgcgcga gaagcgcagc ttattttttt cgtgcacatc cattcgttca tcagtatatc      1920
     caatgttttt cttcatatga cagttataaa taagccgtca gaaggcaaaa ttaaatgatg      1980
     tagcagcaag tcataaagaa ggtgtgggat aggagcgagg agagtgaagt agtgaatgcc      2040
     cgataacatc agaaaagcag taggtttaat tctccttgtt tcgttattaa gtgtaggttt      2100
     atgcaaaccg ctaaaagaat atttactgat tccaacgcaa atgagagtat ttgaaaccca      2160
     aacacaagcg attgaaacga gtttatcggt aaatgctcag acatcagaat cctcagaagc      2220
     gtttacagta aagaaagatc cgcatgaaat caaggtgacg ggcaaaaaat caggtgagtc      2280
     agaattggta tatgatcttg ccggatttcc aattaaaaaa acaaaagtgc atgttcttcc      2340
     tgatttaaaa gttatacctg gcggacaatc aatcggtgta aaacttcatt ccgtcggtgt      2400
     tcttgtcgga tttcatcaaa tcaatacaag tgaaggcaaa aaatctccgg gagaaacggc      2460
     aggaattgaa gcgggcgaca tcattattga gatgaatgga cagaaaattg aaaaaatgaa      2520
     tgatgtagcc ccatttattc aaaaggctgg gaaaactggt gaatctttag acttactgat      2580
     caaacgtgat aaacagaaaa tcaaaacgaa gctgatccca gaaaaggatg aaggagaagg      2640
     caaatacaga atcgggttat atatcagaga ttctgctgct ggcatcggca ctatgacctt      2700
     ttatgaaccg aaaacaaaaa aatacggagc acttggccac gtgatttccg atatggacac      2760
     aaagaaacca attgtagtgg agaatggaga aatcgttaaa tccactgtaa catcaattga      2820
     aaaagggaca ggcggtaatc cgggagaaaa actggcgcga ttttcctcag aacgcaaaac      2880
     gatcggggat attaacagaa acagcccgtt tgggattttc ggcacactgc atcagccgat      2940
     tcaaaacaac atatcagatc aagcattgcc ggttgcgttt tctaccgaag tcaaaaaagg      3000
     gccggctgaa attttaacgg ttattgatga tgacaaagta gaaaaattcg atattgaaat      3060
     cgtcagcaca acgccgcaaa aattccctgc gacaaaagga atggtgttga aaattaccga      3120
     tccaagactg ttgaaagaaa caggaggcat cgtacagggg atgagcggaa gcccgatcat      3180
     tcaaaatgga aaagtgatcg gtgctgtcac ccatgtattt gtaaatgacc cgacaagcgg      3240
     ctacggtgtt catattgaat ggatgctgtc agaagcagga atcgatattt atggaaaaga      3300
     aaaagcaagc tgactgccgg agtttccagg ctttttttat tttgatccct cttcacttct      3360
//

If you have problems or comments...

PBIL Back to PBIL home page