(data stored in ACNUC5340 zone)

EMBL: M31453

ID   M31453; SV 1; linear; mRNA; STD; MAM; 575 BP.
XX
AC   M31453;
XX
DT   22-NOV-1990 (Rel. 25, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Pig liver thioltransferase mRNA, complete cds.
XX
KW   thioltransferase.
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-575
RX   DOI; 10.1016/0378-1119(89)90120-0.
RX   PUBMED; 2583530.
RA   Yang Y., Gan Z.-R., Wells W.W.;
RT   "Cloning and sequencing the cDNA encoding pig liver thioltransferase";
RL   Gene 83(2):339-346(1989).
XX
DR   MD5; 5b944633b4856931910f1307f5719ce1.
DR   Ensembl-Gn; ENSSSCG00000039731; sus_scrofa.
DR   Ensembl-Gn; ENSSSCG00070009533; sus_scrofa_usmarc.
DR   Ensembl-Tr; ENSSSCT00000048927; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000051052; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00070018496; sus_scrofa_usmarc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..575
FT                   /organism="Sus scrofa"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9823"
FT   mRNA            <1..575
FT                   /note="TTF mRNA"
FT   CDS_pept        24..344
FT                   /codon_start=1
FT                   /note="thioltransferase"
FT                   /db_xref="GOA:P12309"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:1KTE"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12309"
FT                   /protein_id="AAA31132.1"
FT                   /translation="MAQAFVNSKIQPGKVVVFIKPTCPFCRKTQELLSQLPFKEGLLEF
FT                   VDITATSDTNEIQDYLQQLTGARTVPRVFIGKECIGGCTDLESMHKRGELLTRLQQIGA
FT                   LK"
XX
SQ   Sequence 575 BP; 160 A; 134 C; 144 G; 137 T; 0 other;
     aattccggca gccgcctgtc agcatggctc aagcatttgt gaacagcaaa atccagcctg        60
     ggaaggtggt agttttcatc aagcccacct gccccttctg cagaaagaca caggagctcc       120
     tcagccaatt gcccttcaaa gaagggcttc tggaatttgt cgatattaca gccaccagtg       180
     acaccaacga gattcaagat tatctgcaac agctcacagg agccagaacg gtacctcggg       240
     tctttatcgg taaagagtgt ataggtggat gcactgatct agaaagtatg cacaagagag       300
     gggagctctt gacccgcctg cagcaaattg gagctctgaa ataattacag cgaggcagac       360
     ccaagctgat agctccctgt agagctggat ggcagtgcag ataatgacag cgcttcctgg       420
     tggatggatg ccgggctacc ttcactcagc tgcaactact gtttacttaa aaattctgaa       480
     atgtgttaac ccaaataatt ggggggagtg ggttttgggg gacaaaacag atttttcttc       540
     tgactctgta ttaaaagtgg aatcaatctt gcccc                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page