(data stored in ACNUC27125 zone)

EMBL: M33375

ID   M33375; SV 1; linear; mRNA; STD; HUM; 1157 BP.
XX
AC   M33375;
XX
DT   26-NOV-1990 (Rel. 25, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Human chlordecone reductase mRNA, complete cds.
XX
KW   chlordecone reductase.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1157
RX   DOI; 10.1021/bi00456a034.
RX   PUBMED; 2187532.
RA   Winters C.J., Molowa D.T., Guzelian P.S.;
RT   "Isolation and characterization of cloned cDNAs encoding human liver
RT   chlordecone reductase";
RL   Biochemistry 29(4):1080-1087(1990).
XX
DR   MD5; ee684658b215ac1ef2629e13ea80aee3.
DR   Ensembl-Gn; ENSG00000198610; homo_sapiens.
DR   Ensembl-Tr; ENST00000263126; homo_sapiens.
DR   Ensembl-Tr; ENST00000380448; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1157
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        44..970
FT                   /codon_start=1
FT                   /note="chlordecone reductase"
FT                   /db_xref="GOA:P17516"
FT                   /db_xref="H-InvDB:HIT000195511.12"
FT                   /db_xref="HGNC:HGNC:387"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="PDB:2FVL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17516"
FT                   /protein_id="AAA35658.1"
FT                   /translation="MPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQ
FT                   VGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFP
FT                   MALKPGETPLPKDENGKVIFDTVDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEMILN
FT                   KPGLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDPNSPVLLE
FT                   DPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVL
FT                   DGLNRNYRYVVMDFLMDHPDYPFSDEY"
FT   variation       103
FT                   /note="a in clone CCDR12; g in clone CCDR33"
FT   variation       259
FT                   /note="c in clone CCDR12; g in clone CCDR33"
FT   variation       432
FT                   /note="c in clone CCDR12; g in clone CCDR33"
FT   variation       876
FT                   /note="t in clone CCDR12; a in clone CCDR33"
FT   variation       929
FT                   /note="c in clone CCDR12; g in clone CCDR33"
XX
SQ   Sequence 1157 BP; 330 A; 266 C; 270 G; 291 T; 0 other;
     cgatcccaaa tatcagcgtg tagagctaaa tgatggtcac ttcatgcccg tattgggatt        60
     tggcacctat gcacctccag aggttccgag gaacagagct gtagaggtca ccaaattagc       120
     aatagaagct ggcttccgcc atattgattc tgcttattta tacaataatg aggagcaggt       180
     tggactggcc atccgaagca agattgcaga tggcagtgtg aagagagaag acatattcta       240
     cacttcaaag ctttggtgca ctttctttca accacagatg gtccaaccag ccttggaaag       300
     ctcactgaaa aaacttcaac tggactatgt tgacctctat cttcttcatt tcccaatggc       360
     tctcaagcca ggtgagacgc cactaccaaa agatgaaaat ggaaaagtaa tattcgacac       420
     agtggatctc tctgccacat gggaggtcat ggagaagtgt aaggatgcag gattggccaa       480
     gtccatcggg gtgtcaaact tcaactgcag gcagctggag atgatcctca acaagccagg       540
     actcaagtac aagcctgtct gcaaccaggt agaatgtcat ccttacctca accagagcaa       600
     actgctggat ttctgcaagt caaaagacat tgttctggtt gcccacagtg ctctgggaac       660
     ccaacgacat aaactatggg tggacccaaa ctccccagtt cttttggagg acccagttct       720
     ttgtgcctta gcaaagaaac acaaacgaac cccagccctg attgccctgc gctaccagct       780
     gcagcgtggg gttgtggtcc tggccaagag ctacaatgag cagcggatca gagagaacat       840
     ccaggttttt gaattccagt tgacatcaga ggatatgaaa gttctagatg gtctaaacag       900
     aaattatcga tatgttgtca tggattttct tatggaccat cctgattatc cattttcaga       960
     tgaatattag catagagggt gttgcacgac atctagcaga aggccctgtg tgtggatggt      1020
     gatgcagagg atgtctctat gctggtgact ggacacacgg cctctggtta aatccctccc      1080
     ctcctgcttg gcaacttcag ctagctagat atatccatgg tccagaaagc aaacataata      1140
     aatttttatc ttgaagt                                                     1157
//

If you have problems or comments...

PBIL Back to PBIL home page