(data stored in SCRATCH zone)

EMBL: M34053

ID   M34053; SV 1; linear; genomic DNA; STD; PRO; 4880 BP.
XX
AC   M34053;
XX
DT   01-JUL-1990 (Rel. 24, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   B.subtilis folic acid biosynthetic operon encoding para-aminobenzoic acid
DE   synthase, component I (pab), glutamine amidotransferase (trpG), pot.
DE   p-aminobenzoate synthesis enzyme (pabC), and pot. dihydropteroate synthase
DE   (sul) genes, complete cds.
XX
KW   dihydropteroate synthase; glutamine amido transferase;
KW   H2-pteridine-CH2OH pyrophosphokinase; para-aminobenzoic acid synthase.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-4880
RX   PUBMED; 2123867.
RA   Slock J., Stahl D.P., Han C.-Y., Six E.W., Crawford I.P.;
RT   "An apparent Bacillus subtilis folic acid biosynthetic operon containing
RT   pab, an amphibolic trpG gene, a third gene required for synthesis of
RT   para-aminobenzoic acid, and the dihydropteroate synthase gene";
RL   J. Bacteriol. 172(12):7211-7226(1990).
XX
DR   MD5; 4efef1e207280f11758f7a59e3025ab3.
DR   GOA; P29252.
DR   InterPro; IPR000550; Hppk.
DR   InterPro; IPR035907; Hppk_sf.
DR   UniProtKB/Swiss-Prot; P29252; HPPK_BACSU.
XX
CC   Draft entry and computer-readable sequence for [Unpublished (1990)]
CC   kindly submitted
CC   by D.P.Stahly, 07-MAY-1990.
CC   Author address: D.P.Stahly
CC   University of Iowa
CC   Dept. of Microbiology
CC   Iowa City, IA 52242
CC   e-mail: cmdsix@vaxa.weeg.uiowa.edu.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4880
FT                   /organism="Bacillus subtilis"
FT                   /strain="W168"
FT                   /sub_strain="PY79"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   regulatory      300..303
FT                   /note="ribosome binding site"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        313..1725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="para-aminobenzoic acid synthase, component I (pab)"
FT                   /db_xref="GOA:P28820"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28820"
FT                   /protein_id="AAA22694.1"
FT                   /translation="MAQRRPAGKKIPFQKDSFLQQFEKLAQSRKHHVLLESARGGRYSI
FT                   AGLDPIATVKGKDGITTIKHGDEMLFKEGDPLRAFHSWFKTLETETNHEFPDFQGGAIG
FT                   FLSYDYARYIENFKMLSLDDLETPDIYFLVFDDIAVYDHQEESLWLITHVNGSDQETAD
FT                   VKLSELEQMWLTELPAVTSREMKPETAGSFAAPFTEDGFSQAVEKIKQYIASGDVFQVN
FT                   LSIRQSQSLSVHPYQIYKTLREVNPSPYMAYLETPDFQIICGSPELLVSKKGKLLETRP
FT                   IAGTRSRGKTNEEDEALANELIHNEKERAEHVMLVDLERNDLGRVSRYGSVRVNEFMAI
FT                   EKYSHVMHIVSNVQGELQDGYDAVDIIHAVFPGGTITGAPKVRTMEIIEELEPTRRGLY
FT                   TGSIGWFGYNHDLQFNIVIRTIYATGGQAFMQSGAGVVIDSVPKHEYKESFKKAFAMQR
FT                   ALELSEEETKIR"
FT   misc_binding    1720..1728
FT                   /bound_moiety="methyltryptophan resistance protein"
FT   regulatory      1724..1730
FT                   /note="ribosome binding site"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1739..2323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="glutamine amidotransferase (trpG)"
FT                   /db_xref="GOA:P28819"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28819"
FT                   /protein_id="AAA22695.1"
FT                   /translation="MILMIDNYDSFTYNLVQYLGELGEELVVKRNDSITIDEIEELSPD
FT                   FLMISPGPCSPDEAGISLEAIKHFAGKIPIFGVCLGHQSIAQVFGGDVVRAERLMHGKT
FT                   SDIEHDGKTIFEGLKNPLVATRYHSLIVKPETLPSCFTVTAQTKEGEIMAIRHNDLPIE
FT                   GVQFHPESIMTSFGKEMLRNFIETYRKEVIA"
FT   regulatory      2306..2313
FT                   /note="ribosome binding site"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        2323..3204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="pot. p-aminobenzoate synthesis enzyme (pabC);
FT                   putative"
FT                   /db_xref="GOA:P28821"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR017824"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28821"
FT                   /protein_id="AAA22696.1"
FT                   /translation="MIYVNGRYMEEKDAVLSPFDHGFLYGIGVFETFRLYEGCPFLLDW
FT                   HIERLERALKDLQIEYTVSKHEILEMLDKLLKLNDIKDGNARVRLNISAGISDKGFVAQ
FT                   TYDKPTVLCFVNQLKPESLPLQKEGKVLSIRRNTPEGSFRLKSHHYLNNMYAKREIGND
FT                   PRVEGIFLTEDGAVAEGIISNVFWRKGRCIYTPSLDTGILDGVTRRFIIENAKDIGLEL
FT                   KTGRYELEALLTADEAWMTNSVLEIIPFTKIEEVNYGSQSGEATSALQLLYKKEIKNMI
FT                   HEKGGRAWRSTQ"
FT   regulatory      3175..3179
FT                   /note="ribosome binding site"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        3186..4043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="pot. dihydropteroate synthase (sul) (EC 2.5.1.15);
FT                   putative"
FT                   /db_xref="GOA:P28822"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28822"
FT                   /protein_id="AAA22697.1"
FT                   /translation="MAQHTIDQTQVIHTKPSALSYKEKTLVMGILNVTPDSFSDGGKYD
FT                   SLDKALLHAKEMIDDGAHIIDIGGESTRPGAECVSEDEEMSRVIPVIERITKELGVPIS
FT                   VDTYKASVADEAVKAGASIINDIWGAKHDPKMASVAAEHNVPIVLMHNRPERNYNDLLP
FT                   DMLSDLMESVKIAVEAGVDEKNIILDPGIGFPKTYHDNLAVMNKLEIFSGLGYPVLLAT
FT                   SRKRFIGRVLDLPPEERAEGTGATVCLGIQKGCDIVRVHDVKQIARMAKMMDAMLNKGG
FT                   VHHG"
FT   regulatory      4023..4027
FT                   /note="ribosome binding site"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4036..4398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="ORF1"
FT                   /db_xref="GOA:P28823"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28823"
FT                   /protein_id="AAA22698.1"
FT                   /translation="MDKVYVEGMEFYGYHGVFTEENKLGQRFKVDLTAELDLSKAGQTD
FT                   DLEQTINYAELYHVCKDIVEGEPVKLVETLAERIAGTVLGKFQPVQQCTVKVIKPDPPI
FT                   PGHYKSVAIEITRKKS"
FT   regulatory      4381..4385
FT                   /note="ribosome binding site"
FT                   /regulatory_class="ribosome_binding_site"
XX
SQ   Sequence 4880 BP; 1512 A; 939 C; 1205 G; 1224 T; 0 other;
     gaattctcgg aggcatctca tcaggtgcgg caatttatgc tgctcttcaa gtagcaaaaa        60
     aactcggaaa aggcaaaaaa gtattggcca tcattccaag taacggcgaa cgttatctaa       120
     gcacgccgct gtaccaattc gattaaaaaa agccaaaact cccggttcgc cgggagtttt       180
     tttatatttc gtgcatcaaa tatgccatgt ctgcgacgaa tgttattctt ggaagagaaa       240
     ttcacttttt tcactaacaa cattgcttta caattaaaaa caagtaaaaa agaaaataga       300
     ggaatgatac aaatggcaca acgcagaccg gcaggcaaaa aaataccttt tcaaaaagac       360
     tcattcttac aacaatttga gaaacttgcg caatcccgga aacatcatgt acttctcgaa       420
     agtgcaagag gcggcagata tagtatagcc ggtcttgatc caattgcgac tgtgaaagga       480
     aaagacggaa taactacaat taagcatggt gatgagatgc tgtttaaaga aggtgatcca       540
     ttacgggcct tccacagctg gtttaaaaca ctggaaacag aaacgaatca tgagttccct       600
     gactttcaag gcggggcaat cgggtttctc agctatgatt acgcacggta cattgaaaat       660
     tttaaaatgc tctcattaga tgatttagaa acaccagata tttattttct tgtttttgat       720
     gatatagcag tttatgacca tcaagaagag tctctatggc tgattactca tgttaatggt       780
     tctgatcagg aaacagcgga tgtgaagcta tctgagttag agcagatgtg gttgactgag       840
     cttcccgctg tcacttcgcg agagatgaag cctgaaacag ctggttcttt cgcggcgcca       900
     tttaccgagg atgggttctc acaagctgta gagaaaatca aacaatacat tgccagcgga       960
     gatgtgtttc aagtcaatct atcaataagg cagtcacagt cactgtctgt ccacccatat      1020
     caaatttaca aaaccttgag agaagtaaat ccttctcctt atatggcgta tttagaaaca      1080
     cctgatttcc aaatcatttg cggatcgcct gaactgcttg tcagcaaaaa gggcaagcta      1140
     ttagagacga gaccgattgc gggcacccgt tccagaggga aaacaaatga agaagacgag      1200
     gcgcttgcaa acgaattgat acacaatgaa aaagaacgcg cggaacatgt catgctggtt      1260
     gatcttgagc gaaatgatct gggaagagta tcacgttacg ggtctgtgcg cgtaaatgaa      1320
     ttcatggcaa ttgaaaaata ctcgcatgtg atgcacattg tgtctaatgt ccaaggtgaa      1380
     ctgcaggatg ggtatgatgc tgtagatatt attcatgctg tgtttcccgg aggaaccatt      1440
     actggtgcac cgaaagtaag aacgatggaa attatagaag aacttgagcc gacacgccga      1500
     gggctttata ctggatctat aggatggttt ggatataatc acgatctgca gtttaatatc      1560
     gtcattcgaa ccatttatgc aaccggaggg caggcattta tgcagtccgg tgcaggagtt      1620
     gtgattgatt ctgttccgaa gcacgaatac aaggaatcat tcaaaaaagc ttttgcgatg      1680
     caaagagcat tagagctgag cgaagaagag acaaaaatta gatgaggtga gcggagaaat      1740
     gattttaatg attgataact acgattcatt cacgtacaac ttggtacagt atttgggcga      1800
     gcttggggaa gagctggttg tgaaacgcaa tgacagcatc acaatcgatg aaattgaaga      1860
     actgtctccg gactttctga tgatatctcc cggaccgtgc agccctgatg aggcgggaat      1920
     cagcctcgaa gcaattaaac atttcgcagg gaaaattcct attttcggtg tatgtctcgg      1980
     acatcagtcc atcgcacaag tgttcggtgg tgatgttgtt agggcagaac ggcttatgca      2040
     cgggaaaacc tcggatatcg agcatgacgg caaaaccatt tttgaagggt tgaaaaatcc      2100
     ccttgttgcg acgcgatacc actcgctgat cgtaaaacct gagacgctgc caagctgttt      2160
     tacagtaaca gcacaaacga aagaaggaga aatcatggct attcgccaca atgacctccc      2220
     gatagagggt gtgcaatttc acccagagtc tattatgacc tcctttggga aagaaatgct      2280
     cagaaatttt attgagacat atcgcaagga agttattgcg tgatgatata tgtgaacggc      2340
     cggtatatgg aggagaaaga tgcagttctt tctccttttg accatgggtt tttatatggg      2400
     atcggtgttt tcgaaacctt caggctctac gaaggctgcc cgtttttgct tgattggcat      2460
     atagagaggc ttgaacgcgc gcttaaggat ctgcaaatcg aatatactgt ttcaaagcat      2520
     gagatccttg agatgctgga caagctgctt aagctaaatg atatcaagga tggcaatgcc      2580
     cgcgtcagac tgaacatatc agcgggaatc agcgataaag gctttgtcgc ccagacgtac      2640
     gataagccca ccgttttatg ctttgtgaat cagctgaaac cagaaagtct tcctttgcaa      2700
     aaagaaggaa aggttttatc gatacggaga aacactccag agggatcgtt ccggttaaaa      2760
     tctcatcatt atctaaataa tatgtatgcg aaacgggaaa ttggaaatga tccgcgtgtc      2820
     gagggaattt tcttaacgga ggatggagct gttgcagagg gtatcatatc taatgtcttc      2880
     tggagaaaag gtcgctgtat ctatacgcca tcgcttgata ccggtattct ggacggcgtc      2940
     acgagacgtt ttatcataga aaatgcaaag gatatcggcc tggagctcaa aacgggccga      3000
     tatgagctag aagctctctt gacagctgac gaagcgtgga tgacgaactc ggttcttgaa      3060
     atcatcccgt ttactaaaat agaagaagta aactatggaa gccaaagcgg agaagcaacc      3120
     tccgctcttc aattgttata caaaaaagaa ataaagaaca tgattcatga aaagggagga      3180
     agagcatggc gcagcacaca atagatcaaa cacaagtaat ccacactaag cccagcgctt      3240
     tatcatataa agagaagacg ctggtgatgg gaattttaaa cgtaacgcct gactctttct      3300
     cggacggcgg aaaatatgac agcttggaca aggcgctgct gcacgcgaaa gagatgatcg      3360
     atgatggtgc ccatatcatt gatattggag gggaatcgac aaggcctggc gctgagtgcg      3420
     tatctgagga tgaggagatg tccagagtca ttccggtgat tgagcggatt acgaaagagc      3480
     ttggtgttcc tatttctgta gacacgtaca aggcttctgt cgcagatgaa gcagtgaaag      3540
     ccggtgcatc cattatcaat gatatttggg gagccaaaca tgatccgaag atggcttccg      3600
     ttgcagctga acataatgtt ccaattgtac tcatgcataa ccgccctgaa agaaactaca      3660
     atgacttatt gccggatatg ctgtcggact taatggagag tgtaaaaatt gctgttgagg      3720
     ccggagtaga cgagaagaac attattcttg atcctggtat cggtttcccg aaaacctatc      3780
     acgataactt ggcagtgatg aacaaactag agattttcag cggattggga tatccggttc      3840
     ttctggcaac ctcccgaaaa agattcatcg gacgtgttct ggatcttccg cctgaggagc      3900
     gggctgaggg cacaggcgcg actgtgtgtc tcggcattca aaaaggctgt gacattgtca      3960
     gggtccatga tgtaaagcaa attgccagaa tggcgaaaat gatggacgcg atgctgaata      4020
     agggaggggt gcaccatgga taaagtttat gtagaaggta tggagtttta cggatatcac      4080
     ggtgtgttca cagaagaaaa caaacttggc cagcggttta aagtcgattt aaccgctgag      4140
     ctggatttaa gcaaagctgg acagacagac gaccttgagc aaacgatcaa ctatgctgag      4200
     ctctatcacg tatgtaaaga tatcgtggaa ggggagcctg tgaaattggt ggaaacgctg      4260
     gcggaacgta ttgctggcac tgttctcgga aaatttcagc ctgttcagca atgtacggtg      4320
     aaagtgatta agccagaccc gccaattccc ggacactata aatcagtagc aattgaaatt      4380
     acgagaaaaa agtcatgaac aacatagctt atattgcact tggatctaat attggagata      4440
     gagaaacgta tttaaggcaa gcagtggctt tactgcatca gcatgctgcg gtgacagtca      4500
     ctaaagtgtc gtctatttac gaaactgacc cggtcggata cgaagatcaa gctcaatttt      4560
     tgaatatggc tgttgaaatc aagacatcat tgaacccttt tgaactcctt gaactgacgc      4620
     agcagataga aaatgaatta ggcagaacaa gggaagtaag atggggaccg cggacggcag      4680
     accttgacat tttgttattt aatcgtgaaa atattgaaac agagcaacta attgttccgc      4740
     atccgagaat gtatgagcgt ttgtttgtcc ttgcgccgct tgcggaaatt tgccagcagg      4800
     ttgaaaaaga ggctacaagc gccgaaacag accaagaagg tgtaagagta tggaagcaga      4860
     aatctggggt agacgaattc                                                  4880
//

If you have problems or comments...

PBIL Back to PBIL home page