(data stored in ACNUC1829 zone)

EMBL: M34453

ID   M34453; SV 1; linear; mRNA; STD; INV; 1058 BP.
XX
AC   M34453;
XX
DT   04-JUL-1990 (Rel. 24, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 4)
XX
DE   S.mansoni 23 kDa integral membrane protein (Sm23) mRNA, complete cds.
XX
KW   integral membrane protein.
XX
OS   Schistosoma mansoni
OC   Eukaryota; Metazoa; Platyhelminthes; Trematoda; Digenea; Strigeidida;
OC   Schistosomatoidea; Schistosomatidae; Schistosoma.
XX
RN   [1]
RP   1-1058
RX   PUBMED; 2324498.
RA   Wright M.D., Henkle K.J., Mitchell G.F.;
RT   "An immunogenic Mr 23,000 integral membrane protein of Schistosoma mansoni
RT   worms that closely resembles a human tumor-associated antigen";
RL   J. Immunol. 144(8):3195-3200(1990).
XX
DR   MD5; c49caf2160b477fa378dbb13bb028329.
DR   EuropePMC; PMC1986741; 17568698.
DR   EuropePMC; PMC4464875; 26055542.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1058
FT                   /organism="Schistosoma mansoni"
FT                   /strain="Puerto Rican"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:6183"
FT   mRNA            <1..1058
FT                   /note="23 kDa integral membrane protein mRNA"
FT   CDS_pept        16..672
FT                   /codon_start=1
FT                   /product="integral membrane protein"
FT                   /note="23 kDa  (Sm23)"
FT                   /db_xref="GOA:P19331"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19331"
FT                   /protein_id="AAA29900.1"
FT                   /translation="MATLGTGMRCLKSCVFVLNIICLLCSLVLIGAGAYVEVKFSQYGD
FT                   NLHKVWQAAPIAIIVVGVIILIVSFLGCCGAIKENVCMLYMYAFFLVVLLIAELAAAIV
FT                   AVVYKDRIDSEIDALMTGALDKPTKEITEFMNLIQSSFHCCGAKGPDDYRGNVPASCKE
FT                   ENLTYTEGCVSVFGAFLKRNLVIVACVAFGVCFFQLLSIVIACCLGRQIKEYENV"
XX
SQ   Sequence 1058 BP; 269 A; 189 C; 219 G; 381 T; 0 other;
     gtcccgtttg aaagtatggc aacgttgggt actggtatgc gttgtctaaa aagttgcgta        60
     ttcgttttga acatcatctg tctgttatgt tccctggtat taattggggc tggtgcctat       120
     gtggaagtca agtttagtca atatggagac aatttacaca aagtctggca ggcagcacct       180
     atcgctatta ttgttgtcgg agtaataatc ctgatagtga gctttctggg ttgttgtgga       240
     gccataaagg aaaacgtctg catgctgtat atgtatgcgt tcttcctcgt cgtacttctg       300
     attgctgagt tggccgctgc catagttgca gttgtttaca aagataggat cgattcagaa       360
     attgatgcat taatgactgg tgctctggat aaaccgacaa aagagataac tgaattcatg       420
     aatttgattc aatcatcatt ccattgctgt ggagccaaag gccctgatga ttatcgtggt       480
     aacgtgccag cctcgtgcaa agaagagaat ttgacctata ccgaaggctg tgtatctgtc       540
     tttggagcat tcttaaaacg caacctggtg attgttgcct gtgttgcatt tggtgtatgc       600
     tttttccagt tgttaagcat tgtcatagcc tgctgtttgg gtcgccaaat aaaggagtat       660
     gagaatgtgt aaacactgca aagaaaacag tatgatgttt atcaatcccg ttctgttttc       720
     cctctggctt ttatgaaatg ttgctttttt attgcctaga taattgtgcc ttggctaata       780
     atcgtgtact cgacttcgtt tacgatataa ttattatact taaatatgat actgtcattc       840
     tcattgtttc acttatcatt cttataccaa atgagctgca ttgattccct ggtatttacc       900
     tacaaactga tgacaaatca tcttcatttt tatggtgtgt cttataacat ttctcgttta       960
     tataatttta agtctttggt ataccttttg ttttacagac cgcttatttt gccgccacag      1020
     cattagacat ttcttgtata aattaattcc gttaactt                              1058
//

If you have problems or comments...

PBIL Back to PBIL home page