(data stored in ACNUC1829 zone)

EMBL: M35252

ID   M35252; SV 1; linear; mRNA; STD; HUM; 1104 BP.
XX
AC   M35252;
XX
DT   20-SEP-1990 (Rel. 25, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 3)
XX
DE   Human CO-029.
XX
KW   tumor-associated antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1104
RA   Szala S., Kasai Y., Steplewski Z., Rodeck U., Koprowski H.,
RA   Linnenbach A.J.;
RT   "Molecular cloning of cDNA for the human tumor-associated antigen CO-029
RT   and identification of related transmembrane antigens";
RL   Proc. Natl. Acad. Sci. U.S.A. 84:6833-6837(1990).
XX
DR   MD5; 3f77952bf923760273ba7869d98b2e85.
DR   Ensembl-Gn; ENSG00000127324; homo_sapiens.
DR   Ensembl-Tr; ENST00000247829; homo_sapiens.
DR   Ensembl-Tr; ENST00000393330; homo_sapiens.
DR   Ensembl-Tr; ENST00000546561; homo_sapiens.
DR   EuropePMC; PMC2649155; 19138406.
DR   EuropePMC; PMC344183; 14749371.
DR   EuropePMC; PMC54632; 2395876.
XX
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by A.J.Linnenbach, 19-JUN-1990, for release after publication.
CC   Author address: A.J.Linnenbach Wistar Institute, Rm 472 3601 Spruce
CC   Street Philadelphia, PA 19104.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1104
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        138..851
FT                   /codon_start=1
FT                   /note="tumor-associated antigen"
FT                   /db_xref="GOA:P19075"
FT                   /db_xref="H-InvDB:HIT000195626.11"
FT                   /db_xref="HGNC:HGNC:11855"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19075"
FT                   /protein_id="AAA35709.1"
FT                   /translation="MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGS
FT                   EDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGI
FT                   LGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGN
FT                   NFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEIL
FT                   GLVFSMVLYCQIGNK"
XX
SQ   Sequence 1104 BP; 332 A; 188 C; 238 G; 346 T; 0 other;
     ctctagagtc gagatccatt gtgctctaaa gtggatacag aaatctctgc aggcaagttg        60
     ctccagagca tattgcagga caagcctgta acgaatagtt aaattcacgg catctggatt       120
     cctaatcctt ttccgaaatg gcaggtgtga gtgcctgtat aaaatattct atgtttacct       180
     tcaacttctt gttctggcta tgtggtatct tgatcctagc attagcaata tgggtacgag       240
     taagcaatga ctctcaagca atttttggtt ctgaagatgt aggctctagc tcctacgttg       300
     ctgtggacat attgattgct gtaggtgcca tcatcatgat tctgggcttc ctgggatgct       360
     gcggtgctat aaaagaaagt cgctgcatgc ttctgttgtt tttcataggc ttgcttctga       420
     tcctgctcct gcaggtggcg acaggtatcc taggagctgt tttcaaatct aagtctgatc       480
     gcattgtgaa tgaaactctc tatgaaaaca caaagctttt gagcgccaca ggggaaagtg       540
     aaaaacaatt ccaggaagcc ataattgtgt ttcaagaaga gtttaaatgc tgcggtttgg       600
     tcaatggagc tgctgattgg ggaaataatt ttcaacacta tcctgaatta tgtgcctgtc       660
     tagataagca gagaccatgc caaagctata atggaaaaca agtttacaaa gagacctgta       720
     tttctttcat aaaagacttc ttggcaaaaa atttgattat agttattgga atatcatttg       780
     gactggcagt tattgagata ctgggtttgg tgttttctat ggtcctgtat tgccagatcg       840
     ggaacaaatg aatctgtgga tgcatcaacc tatcgtcagt caaacccctt taaaatgttg       900
     ctttggcttt gtaaatttaa atatgtaagt gctatataag tcaggagcag ctgtcttttt       960
     aaaatgtctc ggctagctag accacagata tcttctagac atattgaaca catttaagat      1020
     ttgagggata taagggaaaa tgatatgaat gtgtattttt actcaaaata aaagtaactg      1080
     tttaaaaaaa aaaaaaaaaa aaaa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page