(data stored in ACNUC7421 zone)

EMBL: M36540

ID   M36540; SV 1; linear; genomic DNA; STD; PRO; 1885 BP.
XX
AC   M36540;
XX
DT   30-AUG-1990 (Rel. 25, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   S.typhimurium carbamoyl-phosphate synthetase (carA) gene, complete cds, and
DE   carB gene, 5' end.
XX
KW   carbamoyl-phosphate synthase.
XX
OS   Salmonella enterica subsp. enterica serovar Typhimurium
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
XX
RN   [1]
RP   1-1885
RX   DOI; 10.1111/j.1432-1033.1988.tb14299.x.
RX   PUBMED; 2843375.
RA   Kilstrup M., Lu C.D., Abdelal A., Neuhard J.;
RT   "Nucleotide sequence of the carA gene and regulation of the carAB operon in
RT   Salmonella typhimurium";
RL   Eur. J. Biochem. 176(2):421-429(1988).
XX
DR   MD5; 9f0f9d110b47b8fdc46c09c21abde889.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1885
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Typhimurium"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:90371"
FT   repeat_region   232..249
FT                   /note="direct repeat copy A"
FT   repeat_region   232..249
FT                   /note="direct repeat copy B"
FT   repeat_region   379..396
FT                   /note="direct repeat copy C"
FT   regulatory      559..564
FT                   /note="P1 -35 region"
FT                   /regulatory_class="other"
FT   regulatory      583..588
FT                   /note="P1 -10 region"
FT                   /regulatory_class="other"
FT   mRNA            595..>1885
FT                   /note="carAB mRNA (alt.)"
FT   regulatory      629..634
FT                   /note="P2 -35 region"
FT                   /regulatory_class="other"
FT   misc_feature    644..663
FT                   /note="arg-box"
FT   regulatory      653..658
FT                   /note="P2 -10 region"
FT                   /regulatory_class="other"
FT   mRNA            665..>1885
FT                   /note="carAB mRNA (alt.)"
FT   misc_feature    667..684
FT                   /note="arg-box"
FT   CDS_pept        695..1843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="carbamoyl-phosphate synthetase (carA) (ttg  start
FT                   codon)"
FT                   /db_xref="GOA:P14845"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14845"
FT                   /protein_id="AAA27032.1"
FT                   /translation="MIKSALLVLEDGTHFHGRAIGATGSAVGEVVFNTSMTGYQEIVTD
FT                   PSYSRQIVTLTYPHIGNVGTNKADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDSPDAKLALEKAKAFPGLNGMDLAKEVT
FT                   TAETYRWTQGSWTLKDGLPEAKSEDDLPFHVVAYDFGAKRNILRMLVDRGCRLTVVPAQ
FT                   TSAEEVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPLFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDMDRNVVMITAQNHGFAVDEDSLPANLRVTHKSLFDGTLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRQSAK"
FT   CDS_pept        1862..>1885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="carbamoyl-phosphate synthetase (carB)"
FT                   /db_xref="GOA:P14846"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14846"
FT                   /protein_id="AAA27033.1"
FT                   /translation="MPKRTDIK"
XX
SQ   Sequence 1885 BP; 463 A; 436 C; 458 G; 528 T; 0 other;
     agcgccttac ctatgcaaaa ggcacctcga ccagactgat aagactgata tccatcggag        60
     ggggagtgct gttcctcggg ggggcgtttt atctcttttg cttcaatagg ttggcttttt       120
     tatgctgtag tgaggctggt tgtggtccaa tcgtatgtgc ctgtcttaaa gaaaaagaag       180
     ctggatcttt atatcgcgat tgtaattctt attacattgt cttaatttgc tgttttttgt       240
     tgattttatg atgcatttga tttgtttttt atatttttaa tatattgatt tttaaaattt       300
     ttttgtcgtt aactttcttg attttgaatt tttatgcatt taatggcatt gatggctatt       360
     aagtgagttt ttatcgttgt tttttgttgt tttaatgtca aatttgacca tttggtccac       420
     tttttatcat gccagccagt tttttgcgaa ctcaaggaag cgcaagcgtt ttctatcgta       480
     acttagttga ttttttgcct cttaaacaga ataacttcct tataatgtgc aaaataacat       540
     aaaaaacacc ctctttatgt tgacttttat ccggcttaac ttcagaatgc cgccgtttgc       600
     cagaaatcca cgggtaagca aatttgcatt gcttcatact gactgaatga attaatatgc       660
     aaataaagtg agtgaatatt ctctggaggg tgttttgatt aagtcagcgc tattggttct       720
     ggaagacgga acccattttc acggtcgggc cattggggca acgggttcgg cggttgggga       780
     agtcgttttc aatacttcaa tgaccggtta tcaagaaatc gtcactgatc cttcctattc       840
     ccgccaaatc gtcactctta cttatcccca tattggtaat gtcggcacca ataaagccga       900
     tgaagaatcc tctcaggttc atgcgcaagg tttagtgatt cgcgatctgc cgttgattgc       960
     cagcaacttc cgtaacaccg aagacctctc ttcttacctc aaacggcata acattgtggc      1020
     gattgctgat atcgataccc gcaagctgac ccgactgctg cgtgagaaag gcgcacagaa      1080
     cggctgcatc attgcaggcg atagcccgga tgcgaagctg gcgctggaaa aagcgaaagc      1140
     atttcctgga cttaacggta tggatctggc gaaagaagtg accacggcgg aaacttaccg      1200
     ctggacgcag ggtagctgga cgctgaaaga cggtttaccg gaagcgaaat ctgaggatga      1260
     cctgccgttc catgtggtgg cctatgattt cggcgcgaag cgcaacatcc tgcgtatgct      1320
     ggtggatcgc ggctgccgcc tgacggtggt gccagcgcaa acctctgctg aagaggtgct      1380
     gaaaatgaat ccggacggca tcttcctgtc aaacggccct ggcgacccgg ctccgtgcga      1440
     ctacgcgatt actgctatcc agaaattcct cgaaaccgac attccgctat ttggcatctg      1500
     cctcggtcat cagctactgg cgctggcgag cggtgcgaag accgttaaga tgaagttcgg      1560
     ccatcacggc ggcaaccatc cggtaaaaga tatggacaga aacgtggtaa tgatcaccgc      1620
     gcagaaccac ggctttgcgg tggatgaaga ctcgctgccc gccaacctgc gcgtgaccca      1680
     caagtcgctg ttcgacggca ccctgcaagg gattcaccgt accgacaaac cggcgttcag      1740
     cttccagggc cacccggagg cgagccccgg cccgcacgat gcggcgccgc tgttcgacca      1800
     ctttatcgag cttattgagc aataccgtca gtccgcgaaa taatcaggag taataagagc      1860
     catgccaaaa cgtacagata taaaa                                            1885
//

If you have problems or comments...

PBIL Back to PBIL home page