(data stored in SCRATCH zone)

EMBL: M59232

ID   M59232; SV 1; linear; genomic DNA; STD; PRO; 3003 BP.
XX
AC   M59232;
XX
DT   27-MAR-1991 (Rel. 27, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Bacillus subtilis N-acetylmuramoyl-L-alanine amidase (cwlA) gene, complete
DE   cds.
XX
KW   autolysin; N-acetylmuramoyl-L-alanine amidase.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-3003
RX   PUBMED; 1683402.
RA   Foster S.J.;
RT   "Cloning, expression, sequence analysis and biochemical characterization of
RT   an autolytic amidase of Bacillus subtilis 168 trpC2";
RL   J. Gen. Microbiol. 137(8):1987-1998(1991).
XX
DR   MD5; 5ce337e4f934e16db903c2c860c7a7dc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3003
FT                   /organism="Bacillus subtilis"
FT                   /strain="W168"
FT                   /mol_type="genomic DNA"
FT                   /clone="Lambda PE3"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        <1..501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="open reading frame 1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24810"
FT                   /protein_id="AAA62674.1"
FT                   /translation="EFLLYQSLGAGEEDININHTVPITAVAPFSVQLDKSGLTNDGRLK
FT                   VQTEGLNLSSLDTQSKTMDIVFHDKTETIGEGNPFTVGSFKTLLIEVYGTAETSELKFW
FT                   GKSLSGTKRALRGQKVDDGTFATSTKGKSEAWSFSITGFKEIVMELTALTNGNFSVRGT
FT                   AVS"
FT   CDS_pept        546..968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="open reading frame 2"
FT                   /db_xref="GOA:P24811"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24811"
FT                   /protein_id="AAA62675.1"
FT                   /translation="MEETSLFINFETLDLARVYLFGGVKYLDLLLVLSIIDVLTGVIKA
FT                   WKFKKLRSRSAWFGYVRKLLNFFAVILANVIDTVLNLNGVLTFGTVLFYIANEGLSITE
FT                   NLAQIGVKIPSSITDRLQTIENEKEQSKNNADKAAG"
FT   CDS_pept        1013..1831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlA"
FT                   /product="N-Acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="GOA:P24808"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24808"
FT                   /protein_id="AAA62676.1"
FT                   /translation="MAIKVVKNLVSKSKYGLKCPNPMKAEYITIHNTANDASAANEISY
FT                   MKNNSSSTSFHFAVDDKQVIQGIPTNRNAWHTGDGTNGTGNRKSIGVEICYSKSGGVRY
FT                   KAAEKLAIKFVAQLLKERGWGIDRVRKHQDWNGKYCPHRILSEGRWIQVKTAIEAELKK
FT                   LGGKTNSSKASVAKKKTTNTSSKKTSYALPSGIFKVKSPMMRGEKVTQIQKALAALYFY
FT                   PDKGAKNNGIDGVYGPKTADAIRRFQSMYGLTQDGIYGPKTKAKLEALLK"
FT   CDS_pept        1996..2475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="open reading frame 4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24812"
FT                   /protein_id="AAA62677.1"
FT                   /translation="MFKKLLLATSALTFSLSLVLPLDGHAKAQEVTLQAQQEVTYQTPV
FT                   KLSELPTNTTEQSGEFHTNGIKKWIAKEAMKATASALRHGGRIVGEVVDELGGSAGKTF
FT                   AKHTDDVADALDELVKRGDVVEDAIIDTVSSYLIDAGVKSSTARTIASVFTFLAF"
FT   CDS_pept        2491..2853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="open reading frame 5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24809"
FT                   /protein_id="AAA62678.1"
FT                   /translation="MVTVEERLDNLEKKVEKQAFQLRLVQQLAADYDRFGLFDQVLAYD
FT                   LSEKQYQELRELTSQYTDKIKNGEEVSLHNFTEEFKRILKDIEKEVDFEKFISLWLKGP
FT                   EEGFGFSKALHNHFFN"
XX
SQ   Sequence 3003 BP; 1018 A; 490 C; 635 G; 860 T; 0 other;
     gaattcttac tttaccagtc attgggcgca ggtgaagagg atataaacat taaccatact        60
     gttcctatta cagcagttgc tccgttctca gtccagttag ataaaagcgg gttaactaat       120
     gatggtcgtt taaaagttca aactgaaggc ttgaatctta gctcattaga cactcaatca       180
     aaaacaatgg atattgtctt tcacgataaa acagaaacca taggtgaggg taacccattc       240
     accgttggat cattcaaaac gttgctcatt gaggtttatg ggacggctga gacaagtgaa       300
     ttgaagttct ggggtaaatc cttatcggga acaaaaagag cccttagagg gcagaaagtg       360
     gatgacggaa cgtttgccac tagcacaaaa ggaaaatcag aagcttggtc ttttagcatt       420
     actggcttta aagaaattgt tatggagctt acagctttaa caaatggaaa cttttcagtt       480
     agagggacgg ccgtctcata agatccggct gtcctttttt atttgcctcg gaggaggtga       540
     ttagaatgga ggagacaagt ttgtttatca attttgaaac attagattta gcaagagtat       600
     atttatttgg aggggtgaag taccttgatt tacttctagt acttagcata attgacgttt       660
     taacaggagt aatcaaggca tggaaattca aaaaactgcg aagtcgaagc gcatggtttg       720
     gctatgtccg caagctactc aatttctttg cggtcatttt agcaaacgtg attgatacag       780
     tactcaattt gaacggtgtc ttaacctttg gtaccgttct tttttatatc gctaatgaag       840
     gtttgtcaat aactgaaaac ttagcacaga ttggtgttaa aataccatca tcaataacag       900
     atcgattaca aacaattgag aacgaaaaag aacagagtaa gaataacgca gacaaagctg       960
     ctggctaagc cagtggcttt ttttatctta ctgacagaag gagagagggt atatggccat      1020
     taaagttgta aagaatctag tctctaaatc aaagtatgga ttgaaatgtc ctaatccaat      1080
     gaaagctgaa tatatcacta ttcataacac tgcgaatgat gcttcagcag ccaatgagat      1140
     ttcttacatg aagaataact ctagctcaac aagttttcac tttgcagtag acgataaaca      1200
     agtcattcaa ggtattccaa cgaatcgtaa cgcttggcac acaggagatg gaacaaacgg      1260
     tacagggaat cgcaagtcta ttggtgtcga aatttgttat agcaagtcag gaggggtacg      1320
     atataaggca gcggaaaagc ttgctattaa gtttgtggct cagctactta aagaacgtgg      1380
     atggggtatt gatcgagtcc gcaaacatca agactggaat ggtaagtatt gcccgcaccg      1440
     cattttgtca gagggaagat ggattcaagt taagactgca attgaagcag aattgaaaaa      1500
     gttgggcgga aaaacaaact caagcaaagc aagtgtagct aaaaagaaaa caacaaacac      1560
     aagcagcaaa aaaacgtcat atgcgctacc atccggtatt tttaaagtga agagcccaat      1620
     gatgagaggg gaaaaggtaa cacaaattca aaaagcactg gctgcactat acttttaccc      1680
     ggataaagga gcaaaaaaca acggcattga cggcgtgtat ggtccgaaaa cagcagatgc      1740
     aattagacga ttccagtcta tgtacgggct tactcaagac ggtatttacg gaccaaaaac      1800
     gaaagcgaaa cttgaagctc tcttgaagta aataaatagt ctccttgagt atctttctca      1860
     aggagatact tatgtttatt ttgttacaga tagttcaaaa ttattctaat atttgagtaa      1920
     aaagtattat ttttctagtc tgaacataat gttatcattt acatgtaaat aatttaaaag      1980
     aaagggattg atttcatgtt taagaaatta cttttagcaa catctgcatt aacattctct      2040
     ttatcattag ttcttccgtt ggatggacat gccaaagctc aagaggtaac attacaggca      2100
     cagcaggaag tcacttatca aactcccgtt aaactatccg aattaccaac taatacaact      2160
     gaacaatctg gtgaatttca cacaaatggt attaaaaaat ggattgctaa agaagcaatg      2220
     aaggcaacag ccagtgcgct tcgacatggt gggagaattg ttggtgaggt agtcgatgag      2280
     ttaggtggat cagcaggaaa aacattcgca aaacatactg atgatgtagc agatgctttg      2340
     gacgagttag ttaaacgagg tgacgttgtg gaggacgcaa ttattgacac ggtttcctca      2400
     tatctaattg atgctggtgt aaaatcttct acagctagaa ctattgcaag tgtatttact      2460
     ttcttagctt tttaattgag gtgatttgaa ttggtaacag tagaagaaag gcttgacaac      2520
     ctagaaaaaa aagtcgagaa gcaggctttt caactaaggt tagtccaaca attagcagct      2580
     gattatgatc ggtttggctt atttgatcaa gttttggcct atgatttaag tgaaaaacag      2640
     tatcaagaat taagagagtt aacgagccag tacactgata agattaaaaa tggcgaagag      2700
     gtctctcttc ataactttac tgaagaattt aaaagaattt tgaaagatat tgaaaaagaa      2760
     gtggatttcg aaaagtttat ttctctctgg ttaaagggac cagaagaagg ttttggattt      2820
     tctaaagctt tacataacca tttctttaat taaagataag gaccagccac ataataagct      2880
     ggtctttctt tattttccct caagttcgaa ctcctatgaa cagaatacca ggtatctatc      2940
     cttccaaata tattgttatt agcttgaggg tttgtgtgtt tttcttcatt aatcatagaa      3000
     ttc                                                                    3003
//

If you have problems or comments...

PBIL Back to PBIL home page