(data stored in ACNUC31108 zone)

EMBL: M59907

ID   M59907; SV 1; linear; mRNA; STD; HUM; 850 BP.
XX
AC   M59907; X56941;
XX
DT   29-JUL-1991 (Rel. 28, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Homo sapiens melanoma-associated antigen (ME491) mRNA, complete cds.
XX
KW   melanoma-associated antigen ME491.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-850
RX   DOI; 10.1089/dna.1990.9.479.
RX   PUBMED; 2171551.
RA   Rapp G., Freudenstein J., Klaudiny J., Mucha J., Wempe F., Zimmer M.,
RA   Scheit K.H.;
RT   "Characterization of three abundant mRNAs from human ovarian granulosa
RT   cells";
RL   DNA Cell Biol. 9(7):479-485(1990).
XX
DR   MD5; c06e8a391771a29fdcbddbc858f87b25.
DR   Ensembl-Gn; ENSG00000135404; homo_sapiens.
DR   Ensembl-Tr; ENST00000257857; homo_sapiens.
DR   Ensembl-Tr; ENST00000420846; homo_sapiens.
DR   Ensembl-Tr; ENST00000546939; homo_sapiens.
DR   Ensembl-Tr; ENST00000549117; homo_sapiens.
DR   Ensembl-Tr; ENST00000550776; homo_sapiens.
DR   Ensembl-Tr; ENST00000552692; homo_sapiens.
DR   Ensembl-Tr; ENST00000552754; homo_sapiens.
XX
CC   On Feb 26, 2002 this sequence version replaced gi:31897.
CC   Draft entry and computer-readable sequence for [DNA 9, 479-485
CC   (1990)] kindly submitted
CC   by K.H.Scheit, 27-AUG-1990.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..850
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="pHGR74; pHGR11"
FT                   /cell_type="granulosa"
FT                   /tissue_type="ovary"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        51..767
FT                   /codon_start=1
FT                   /gene="ME491"
FT                   /product="melanoma-associated antigen"
FT                   /db_xref="GOA:P08962"
FT                   /db_xref="H-InvDB:HIT000195910.12"
FT                   /db_xref="HGNC:HGNC:1692"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="InterPro:IPR042028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08962"
FT                   /protein_id="AAA63235.1"
FT                   /translation="MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQ
FT                   GATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAG
FT                   YVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKN
FT                   RVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIV
FT                   FACCLVKSIRSGYEVM"
XX
SQ   Sequence 850 BP; 174 A; 184 C; 262 G; 230 T; 0 other;
     ggcgggagag gaacgcgcag ccagccttgg gaagcccagg cccggcagcc atggcggtgg        60
     aaggaggaat gaaatgtgtg aagttcttgc tctacgtcct cctgctggcc ttttgcgcct       120
     gtgcagtggg actgattgcc gtgggtgtcg gggcacagct tgtcctgagt cagaccataa       180
     tccagggggc tacccctggc tctctgttgc cagtggtcat catcgcagtg ggtgtcttcc       240
     tcttcctggt ggcttttgtg ggctgctgcg gggcctgcaa ggagaactat tgtcttatga       300
     tcacgtttgc catctttctg tctcttatca tgttggtgga ggtggccgca gccattgctg       360
     gctatgtgtt tagagataag gtgatgtcag agtttaataa caacttccgg cagcagatgg       420
     agaattaccc gaaaaacaac cacactgctt cgatcctgga caggatgcag gcagatttta       480
     agtgctgtgg ggctgctaac tacacagatt gggagaaaat cccttccatg tcgaagaacc       540
     gagtccccga ctcctgctgc attaatgtta ctgtgggctg tgggattaat ttcaacgaga       600
     aggcgatcca taaggagggc tgtgtggaga agattggggg ctggctgagg aaaaatgtgc       660
     tggtggtagc tgcagcagcc cttggaattg cttttgtcga ggttttggga attgtctttg       720
     cctgctgcct cgtgaagagt atcagaagtg gctacgaggt gatgtagggg tctggtctcc       780
     tcagcctcct catctggggg agtggaatag tatcctccag gtttttcaat taaacggatt       840
     attttttcag                                                              850
//

If you have problems or comments...

PBIL Back to PBIL home page