(data stored in ACNUC7421 zone)

EMBL: M60064

ID   M60064; SV 1; linear; genomic DNA; STD; PRO; 1658 BP.
XX
AC   M60064; M36054;
XX
DT   16-JAN-1991 (Rel. 26, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   S.typhimurium glutamate 1-semialdehyde aminotransferase (hemL) gene,
DE   complete cds.
XX
KW   glutamate 1-semialdehyde aminotransferase.
XX
OS   Salmonella enterica subsp. enterica serovar Typhimurium
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
XX
RN   [1]
RP   1-1658
RX   PUBMED; 2254275.
RA   Elliott T., Avissar Y.J., Rhie G.E., Beale S.I.;
RT   "Cloning and sequence of the Salmonella typhimurium hemL gene and
RT   identification of the missing enzyme in hemL mutants as
RT   glutamate-1-semialdehyde aminotransferase";
RL   J. Bacteriol. 172(12):7071-7084(1990).
XX
DR   MD5; b7e1301593f5c5f6aec69a957818f8c3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1658
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Typhimurium"
FT                   /map="5"
FT                   /strain="LT2a"
FT                   /mol_type="genomic DNA"
FT                   /clone="pTE290"
FT                   /db_xref="taxon:90371"
FT   gene            231..1511
FT                   /gene="hemL"
FT   CDS_pept        231..1511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /product="glutamate 1-semialdehyde aminotransferase"
FT                   /db_xref="GOA:P0CL07"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CL07"
FT                   /protein_id="AAA63535.1"
FT                   /translation="MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLY
FT                   DVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVP
FT                   TMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQP
FT                   NSPGVPADFAKHTLTCTYNDLTSVRAAFEQYPQEIASIIVEPVAGNMNCVPPLPEFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAFGGRRD
FT                   VMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGIHETLDELTTRLAEGLCEAAQ
FT                   EAGIPLVVNHVGGMFGIFFTDAESVTCYQDVMACDVERFKRFFHLMLEEGVYLAPSAFE
FT                   AGFMSVAHSMDDINNTIDAARRVFAKL"
XX
SQ   Sequence 1658 BP; 363 A; 448 C; 478 G; 369 T; 0 other;
     gatctctgcg ccgtaaacgc acaatttgct gagctaaaaa ggtggaagtg tctgttttca        60
     tcagaagatc attaattggt aatacaaatc taaagtcggc attctactcg ccaacgccgc       120
     gaaaatcccc tgcaaatcgt attgtttcaa atgcgtaaaa ctttcataac cttctctgaa       180
     taacttagaa tagcgggtat tcactttttc tacgaaccag gaatctttcc atgagtaagt       240
     ctgaaaatct ctatagcgcg gcccgcgagc tgatccccgg cggcgtgaac tcccctgttc       300
     gcgccttcac tggcgtgggc ggcaccccgc tgtttatcga aaaagcggac ggcgcttatc       360
     tttatgatgt cgatggcaaa gcgtatatcg actatgtcgg ttcctgggga ccaatggtac       420
     tggggcataa ccatccggct atccgcaatg cggtgatcga agctgcggag cgcggtttaa       480
     gcttcggcgc gccaaccgaa atggaagtga aaatggcgga actggtcacc aacctggtgc       540
     cgaccatgga catggtgcgc atggtgaact ccggcaccga agcgacgatg agcgctattc       600
     gcctggcgcg tggttttact ggccgcgata agattatcaa attcgaaggc tgctaccacg       660
     gccacgcaga ctgtctgctg gtcaaagccg gttctggcgc gctgacgctc ggtcagccga       720
     actcgccggg cgtgccggca gatttcgcga aacatacgct gacctgcact tataacgatc       780
     tgacgtcagt gcgcgcggca tttgaacaat atccgcagga aatcgccagt atcatcgtcg       840
     aacccgtggc gggcaatatg aactgcgtcc cgccgctgcc ggaatttctg ccaggtctgc       900
     gcgccttgtg cgatgagttc ggcgcgctgc tgattatcga cgaagtaatg accggttttc       960
     gcgtagcgct ggccggagcc caggattact acggcgtcgt gccggacctg acctgtctgg      1020
     gtaaaatcat cggcggcggg atgccggtag gcgcgtttgg cggtcgtcgc gatgtaatgg      1080
     atgcgctggc gccgacgggc ccggtttacc aggcgggcac cctttccggc aacccgattg      1140
     cgatggcggc cggtttcgcc tgcctgaatg aagtcgccca gcccggcatt catgaaacgc      1200
     tggatgagct caccacccgc ctggcggaag ggctgtgcga agcggcgcag gaggcgggga      1260
     tcccactggt cgtcaaccat gtcggcggca tgttcgggat tttcttcacc gacgctgaga      1320
     gcgtaacctg ctatcaggac gtgatggcgt gcgacgtgga acgctttaag cgtttcttcc      1380
     acctgatgct ggaggaaggc gtatatctgg cgccatcggc gtttgaggcg ggctttatgt      1440
     cggtcgcaca cagcatggac gacattaata atactattga cgccgcgcgt cgggtgtttg      1500
     cgaaactgta aaagagaacg tccagaaaca acgtaggccg ggtaaggcga agccgccacc      1560
     cggttttttt ttggttcata ccaggttagc gtgaatcttc gccaaacacc cagcccccct      1620
     aaagctcatc aataatatac tggaagctac aggtcgac                              1658
//

If you have problems or comments...

PBIL Back to PBIL home page