(data stored in ACNUC16935 zone)

EMBL: M62429

ID   M62429; SV 1; linear; mRNA; STD; MAM; 636 BP.
XX
AC   M62429; M37794;
XX
DT   26-JAN-1992 (Rel. 30, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Bovine polyubiquitin mRNA, 3' end, clone rpub2.
XX
KW   polyubiquitin; ubiquitin.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RP   1-636
RX   DOI; 10.1016/0042-6822(91)90074-L.
RX   PUBMED; 1846490.
RA   Meyers G., Tautz N., Dubovi E.J., Thiel H.-J.;
RT   "Viral cytopathogenicity correlated with integration of ubiquitin-coding
RT   sequences";
RL   Virology 180(2):602-616(1991).
XX
DR   MD5; fc37c01bdb402bd75b248356e00b2863.
DR   Ensembl-Gn; ENSBTAG00000017246; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000022919; bos_taurus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..636
FT                   /organism="Bos taurus"
FT                   /mol_type="mRNA"
FT                   /cell_line="MBDK"
FT                   /tissue_lib="lambda ZAPII"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:9913"
FT   mRNA            <1..636
FT                   /product="polyubiquitin"
FT   CDS_pept        <1..496
FT                   /codon_start=2
FT                   /product="polyubiquitin"
FT                   /db_xref="GOA:P0CG53"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:5TR4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CG53"
FT                   /protein_id="AAA30720.1"
FT                   /translation="TLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE
FT                   GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
FT                   EPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
FT                   C"
XX
SQ   Sequence 636 BP; 165 A; 171 C; 154 G; 146 T; 0 other;
     aaccctgcac ctggtcctcc gtctgagggg tggtatgcag atcttcgtga agaccctgac        60
     cggcaagacc atcaccctgg aggtggagcc cagtgacacc atcgagaacg tgaaggccaa       120
     gatccaggat aaggaaggca ttccccctga ccagcagagg ctcatctttg ccggcaagca       180
     gctggaagat ggccgcactc tttctgatta caacatccag aaagagtcga ccctgcacct       240
     ggtcctccgt ctgaggggtg gtatgcagat cttcgtgaag accctgaccg gcaagaccat       300
     caccctggaa gtggagccca gtgacaccat cgagaacgtg aaggccaaga tccaggataa       360
     ggaaggcatt ccccctgacc agcagaggct catctttgcc ggcaagcagc tggaagatgg       420
     ccgcactctt tctgattaca acatccagaa agagtcgacc ctgcacctgg tccttcgtct       480
     gaggggtggc tgttaattct tcagtcttct attcataatg ttcaatgatg acatccttct       540
     gcactctagc catttacccc aatttaagtt tagaaattac cagtttcagt aatagctgaa       600
     cctgttcaaa atattaataa aagttttgtt gcatgc                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page