(data stored in SCRATCH zone)

EMBL: M63264

ID   M63264; SV 1; linear; genomic DNA; STD; PRO; 2935 BP.
XX
AC   M63264;
XX
DT   09-JUL-1991 (Rel. 28, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Bacillus subtilis L-asparaginase (ansA) gene, complete CDS; L-aspartase
DE   (ansB) gene, complete CDS.
XX
KW   L-asparaginase; L-aspartase.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-2935
RX   PUBMED; 1711029.
RA   Sun D., Setlow P.L.;
RT   "Cloning, nucleotide sequence, and expression of the Bacillus subtilis ans
RT   operon, which codes for L-asparaginase and L-aspartase";
RL   J. Bacteriol. 173(12):3831-3845(1991).
XX
DR   MD5; 8bdd59f4c2fa9cb054ac6efdede5f080.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2935
FT                   /organism="Bacillus subtilis"
FT                   /strain="W168"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   regulatory      244..249
FT                   /gene="ansA"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      267..272
FT                   /gene="ansA"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      330..338
FT                   /gene="ansA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        345..1334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansA"
FT                   /product="L-asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="GOA:P26900"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26900"
FT                   /protein_id="AAA22243.1"
FT                   /translation="MKKLLMLTTGGTIASVEGENGLAPGVKADELLSYVSKLDNDYTME
FT                   TQSLMNIDSTNMQPEYWVEIAEAVKENYDAYDGFVITHGTDTMAYTSAALSYMLQHAKK
FT                   PIVITGSQIPITFQKTDAKKNITDAIRFACEGVGGVYVVFDGRVIQGTRAIKLRTKSYD
FT                   AFESINYPYIAFINEDGIEYNKQVTEPENDTFTVDTSLCTDVCLLKLHPGLKPEMFDAL
FT                   KSMYKGIVIESYGSGGVPFEGRDILSKVNELIESGIVVVITTQCLEEGEDMSIYEVGRR
FT                   VNQDLIIRSRNMNTEAIVPKLMWALGQSSDLPVVKRIMETPIADDVVL"
FT   regulatory      1361..1370
FT                   /gene="ansB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1379..2806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansB"
FT                   /product="L-aspartase"
FT                   /EC_number="4.3.1.1"
FT                   /db_xref="GOA:P26899"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26899"
FT                   /protein_id="AAA22244.1"
FT                   /translation="MLNGQKEYRVEKDFLGEKQIEADVYYGIQTLRASENFPITGYKIH
FT                   EEMINALAIVKKAAALANMDVKRLYEGIGQAIVQAADEILEGKWHDQFIVDPIQGGAGT
FT                   SMNMNANEVIGNRALEIMGHKKGDYIHLSPNTHVNMSQSQNDVFPTAIHISTLKLLEKL
FT                   LKTMEDMHSVFKQKAQEFHSVIKMGRTHLQDAVPIRLGQEFEAYSRVLERDIKRIKQSR
FT                   QHLYEVNMGATAVGTGLNADPEYIKQVVKHLADISGLPLVGADHLVDATQNTDAYTEVS
FT                   ASLKVCMMNMSKIANDLRLMASGPRAGLAEISLPARQPGSSIMPGKVNPVMAELINQIA
FT                   FQVIGNDNTICLASEAGQLELNVMEPVLVFNLLQSISIMNNGFRSFTDNCLKGIEANEK
FT                   RMKQYVEKSAGVITAVNPHLGYEAAARIAREAIMTGQSVRDLCLQHDVLTEEELDIILN
FT                   PYEMTKPGIAGKELLEK"
XX
SQ   Sequence 2935 BP; 910 A; 589 C; 693 G; 743 T; 0 other;
     tgtcaaagag gtcagccagc atggcaagcg cttcaagtga aggccgtcgg tagcctgact        60
     cgtagccggc atatgtgctt tttgcgatac cgagaaggtc agctgtatat tgaagcgacc       120
     aatttttctt ttttctcaat tcagttaaac gatctagatt catgaacttc cgctcctttt       180
     tcaccttgag ctgattatat catataggta ttaggaagtg tacgcgaatt gaataataat       240
     gtcttgcgta ttttattttc cgtgtctata attgcattaa aagtatgcga aaagcgaata       300
     ccttctcgca acccatcttt agatacagtg aagaggtgca tggtatgaaa aaattattga       360
     tgttgacaac tgggggaacg attgcttcag ttgaagggga aaatgggctg gctcccggag       420
     tcaaggctga tgaattatta agttacgtat caaaacttga taacgattac acaatggaaa       480
     ctcagtcgct tatgaatata gacagcacca atatgcagcc tgaatactgg gtggaaatag       540
     cagaagccgt taaggaaaat tatgatgcct atgacgggtt tgttattact cacggtacag       600
     atacaatggc ctatacatct gccgcactat cgtatatgct gcagcatgcc aaaaagccga       660
     ttgtcatcac cggctcgcag attccgatca cgttccaaaa aaccgatgcc aaaaaaaata       720
     ttacagatgc cattcgattt gcctgtgaag gcgtgggcgg cgtttatgtt gtgtttgacg       780
     gcagagtcat tcagggaacg cgtgcgatca aattaagaac gaaaagctac gacgcatttg       840
     aaagcatcaa ttacccatat atcgctttta tcaatgaaga cgggatcgaa tacaacaaac       900
     aagtaacgga acctgagaac gacaccttca cagttgacac ttcactatgc acagatgtat       960
     gtctgctgaa gctgcatcca ggcttaaagc ccgaaatgtt tgatgccctg aaaagcatgt      1020
     acaaaggaat tgtcattgag agttatggca gcggaggagt gccgtttgaa ggcagagaca      1080
     ttttgtcaaa agtgaatgaa ctgatcgaaa gcggcattgt cgtcgtcatt acgactcaat      1140
     gtcttgaaga aggcgaagac atgagcattt acgaggttgg ccgcagagtc aaccaagact      1200
     taattatccg atcaagaaat atgaacacag aagcaattgt gccaaaattg atgtgggcgc      1260
     taggtcagtc ttcggatctt cctgtcgtca agagaattat ggaaacgccg atagctgatg      1320
     acgttgtcct gtaaaatgta aaaacgataa ccagcaaaga gaaagaaggt taaagattat      1380
     gttaaacggc caaaaagaat atcgcgtgga aaaagacttc cttggggaaa aacaaattga      1440
     agcagatgtt tattacggaa ttcagacgct ccgtgcttct gaaaattttc cgatcacagg      1500
     atacaaaatc catgaggaaa tgattaacgc actggcgatt gtgaaaaaag ctgcggctct      1560
     tgccaacatg gacgtgaaac ggctgtatga aggaattggc caagctatcg tacaagccgc      1620
     tgacgagatt ctggaaggca agtggcacga tcagtttatc gtcgatccga ttcagggcgg      1680
     tgccggaact tctatgaaca tgaacgcgaa tgaggttatc ggaaaccggg cgcttgaaat      1740
     catgggacat aaaaagggag attatatcca tttaagtcca aacacacatg tgaacatgtc      1800
     acagtctcag aacgatgtgt tcccgactgc tatccatatt tccacattga agctcttaga      1860
     aaaactgctg aaaacaatgg aagatatgca tagtgtgttt aaacaaaaag cacaggagtt      1920
     tcactctgtt attaaaatgg gccggacaca ccttcaagat gcggttccga tccgtcttgg      1980
     ccaggaattc gaagcttaca gccgtgttct cgagcgtgat atcaaacgaa tcaagcaatc      2040
     gcgccagcac ctgtatgaag tcaacatggg cgcaactgct gttggtacag ggctgaacgc      2100
     tgatcctgaa tatatcaaac aggtagtaaa gcaccttgct gatattagcg ggcttcctct      2160
     tgtcggcgct gatcatcttg ttgatgcgac acaaaataca gatgcctata cagaggtatc      2220
     agcttcatta aaagtctgca tgatgaacat gtcgaagatc gcaaacgacc tgcgcttaat      2280
     ggcgtcggga ccgcgcgccg gacttgcgga aatttctctg cctgcacgtc agccgggttc      2340
     atctattatg ccggggaaag tcaatccggt tatggcggag ctgatcaacc aaattgcgtt      2400
     ccaggttatc ggaaatgaca atacaatctg ccttgcttca gaagccggcc agcttgagtt      2460
     gaacgtcatg gagcccgtgc ttgtctttaa tttgcttcaa tccatcagca tcatgaacaa      2520
     cggcttccgt tcgttcactg acaactgctt aaaaggcatt gaagccaacg aaaagcgtat      2580
     gaagcaatac gtagaaaaaa gcgcaggcgt gatcacagct gtcaatccgc atcttgggta      2640
     tgaagcggca gctagaattg ccagggaagc aattatgaca gggcaatctg tccgggatct      2700
     ttgtctgcag catgatgtgc tgactgaaga agaattggat attattttaa acccatatga      2760
     gatgaccaaa ccaggtatcg cagggaaaga actattagaa aaataaaatt tgtataaaat      2820
     acagcttatt catctccgaa tagtcggatg aataagctgt ttacaacata gggatgagga      2880
     agtatagtat acgtgttgca ctatatattg aaagcgtttt agcttttaca tgaag           2935
//

If you have problems or comments...

PBIL Back to PBIL home page