(data stored in ACNUC7820 zone)

EMBL: M64381

ID   M64381; SV 1; linear; mRNA; STD; ROD; 954 BP.
XX
AC   M64381;
XX
DT   20-APR-1991 (Rel. 28, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Rat olfactory protein mRNA, complete cds.
XX
KW   olfactory protein; receptor-like protein.
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-954
RX   DOI; 10.1016/0092-8674(91)90418-X.
RX   PUBMED; 1840504.
RA   Buck L., Axel R.;
RT   "A novel multigene family may encode odorant receptors: a molecular basis
RT   for odor recognition";
RL   Cell 65(1):175-187(1991).
XX
DR   MD5; 6545d27f629c403051fd7063ce0492aa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..954
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="olfactory epithelium"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        1..954
FT                   /codon_start=1
FT                   /product="olfactory protein"
FT                   /db_xref="GOA:P23268"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23268"
FT                   /protein_id="AAA41744.1"
FT                   /translation="MESGNSTRRFSSFFLLGFTENPQLHFLIFALFLSMYLVTVLGNLL
FT                   IIMAIITQSHLHTPMYFFLANLSFVDICFTSTTIPKMLVNIYTQSKSITYEDCISQMCV
FT                   FLVFAELGNFLLAVMAYDRYVAXCHPLCYTVIVNHRLCILLLLLSWVISIFHAFIQSLI
FT                   VLQLTFCGDVKIPHFFCELNQLSQLTCSDNFPSHLIMNLVPVMLAAISFSGILYSYFKI
FT                   VSSIHSISTVQGKYKAFSTCASHLSIVSLFYSTGLGVYVSSAVVQSSHSAASASVMYTV
FT                   VTPMLNPFIYSLRNKDVKRALERLLEGNCKVHHWTG"
XX
SQ   Sequence 954 BP; 230 A; 238 C; 177 G; 308 T; 1 other;
     atggaatcag ggaacagcac aagaagattt tcaagttttt ttcttcttgg atttacagaa        60
     aacccacaac ttcacttcct catttttgca ctattcctgt ccatgtacct ggtaacagtg       120
     cttgggaacc tgcttatcat tatggccatc atcacacagt ctcatttgca tacacccatg       180
     tactttttcc ttgctaacct atcctttgtg gacatctgtt tcacctccac caccatccca       240
     aagatgttgg taaatatata cacccagagc aagagcatca cctatgaaga ctgtattagc       300
     cagatgtgtg tcttcttggt tttcgcagaa ttgggcaact ttctcctggc tgtgatggcc       360
     tatgaccgat atgtggctan ctgtcaccca ctgtgttaca cagtcattgt gaaccaccgg       420
     ctctgtatcc tgctgcttct gctgtcctgg gttatcagca ttttccatgc cttcatacag       480
     agcttaattg tgctacagtt gaccttctgt ggagatgtga aaatccctca cttcttctgt       540
     gaacttaatc agctgtccca actcacctgt tcagacaact ttccaagtca cctcataatg       600
     aatcttgtac ctgttatgtt ggcagccatt tccttcagtg gcatccttta ctcttatttc       660
     aagatagtat cctccataca ttctatctcc acagttcagg ggaagtacaa ggcattttct       720
     acttgtgcct ctcacctttc cattgtctcc ttattttata gtacaggcct cggagtgtac       780
     gtcagttctg ctgtggtcca aagctcacat tctgctgcaa gtgcttcggt catgtatact       840
     gtggtcaccc ccatgctgaa ccccttcatt tatagtctaa ggaataaaga tgtgaagaga       900
     gctctggaaa gactgttaga aggaaactgt aaagtgcatc attggactgg atga             954
//

If you have problems or comments...

PBIL Back to PBIL home page