(data stored in SCRATCH zone)

EMBL: M74010

ID   M74010; SV 1; linear; genomic DNA; STD; PRO; 1495 BP.
XX
AC   M74010;
XX
DT   19-AUG-1992 (Rel. 33, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 5)
XX
DE   Bacillus subtilis lipase (lipA) gene, complete cds.
XX
KW   lipA gene; lipase.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-1495
RX   DOI; 10.1016/0167-4781(92)90023-S.
RX   PUBMED; 1320940.
RA   Dartois V., Baulard A., Schanck K., Colson C.;
RT   "Cloning, nucleotide sequence and expression in Escherichia coli of a
RT   lipase gene from Bacillus subtilis 168";
RL   Biochim. Biophys. Acta 1131(3):253-260(1992).
XX
DR   MD5; e764acef909abe11813c9c9b07d23e9d.
DR   EuropePMC; PMC154548; 12732514.
DR   EuropePMC; PMC387885; 15102773.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1495
FT                   /organism="Bacillus subtilis"
FT                   /strain="W168"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   regulatory      414..419
FT                   /gene="lipA"
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      440..445
FT                   /gene="lipA"
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      465..472
FT                   /gene="lipA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        478..1116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /product="lipase"
FT                   /EC_number="3.1.1.3"
FT                   /db_xref="GOA:P37957"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:1I6W"
FT                   /db_xref="PDB:1ISP"
FT                   /db_xref="PDB:1R4Z"
FT                   /db_xref="PDB:1R50"
FT                   /db_xref="PDB:1T2N"
FT                   /db_xref="PDB:1T4M"
FT                   /db_xref="PDB:2QXT"
FT                   /db_xref="PDB:2QXU"
FT                   /db_xref="PDB:3D2A"
FT                   /db_xref="PDB:3D2B"
FT                   /db_xref="PDB:3D2C"
FT                   /db_xref="PDB:3QMM"
FT                   /db_xref="PDB:3QZU"
FT                   /db_xref="PDB:5CRI"
FT                   /db_xref="PDB:5CT4"
FT                   /db_xref="PDB:5CT5"
FT                   /db_xref="PDB:5CT6"
FT                   /db_xref="PDB:5CT8"
FT                   /db_xref="PDB:5CT9"
FT                   /db_xref="PDB:5CTA"
FT                   /db_xref="PDB:5CUR"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37957"
FT                   /protein_id="AAA22574.1"
FT                   /translation="MKFVKRRIIALVTILMLSVTSLFALQPSAKAAEHNPVVMVHGIGG
FT                   ASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDI
FT                   VAHSMGGANTLYYIKNLDGGNKVANVVTVGGANRLTTGKALPGTDPNQKILYTSIYSSA
FT                   DMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN"
FT   regulatory      1127..1155
FT                   /gene="lipA"
FT                   /regulatory_class="terminator"
XX
SQ   Sequence 1495 BP; 459 A; 307 C; 344 G; 385 T; 0 other;
     gtccaaatga cggaagctac ctgttgacgc tgctgtaaaa ccggagcaaa ggggattgta        60
     tttgccggtt ctgggaacgg gtctttatct gatgcagccg aaaaaggggc ggacagcgca       120
     gtcaaaaaag gcgttacagt ggtgcgctct acccgcacgg gaaatggtgt cgtcacacca       180
     aaccaagact atgcggaaaa ggacttgctg gcatcgaact ctttaaaccc ccaaaaagca       240
     cggatgttgc tgatcgttgc tcttaccaaa acaaatgatc ctcaaaaaat ccaagcttat       300
     ttcaatgagt attgaagaaa agaaggcgaa taagccttct tttttttggc tttttaggac       360
     caataatgac ctctgaatct taaaatttct ttaaaaataa gccaaaatta ccctttactt       420
     aattaatttg gtaacgtaat ataattggag aatttgttac aaaaaaagga ggatattatg       480
     aaatttgtaa aaagaaggat cattgcactt gtaacaattt tgatgctgtc tgttacatcg       540
     ctgtttgcgt tgcagccgtc agcaaaagcc gctgaacaca atccagtcgt tatggttcac       600
     ggtattggag gggcatcatt caattttgcg ggaattaaga gctatctcgt atctcagggc       660
     tggtcgcggg acaagctgta tgcagttgat ttttgggaca agacaggcac aaattataac       720
     aatggaccgg tattatcacg atttgtgcaa aaggttttag atgaaacggg tgcgaaaaaa       780
     gtggatattg tcgctcacag catggggggc gcgaacacac tttactacat aaaaaatctg       840
     gacggcggaa ataaagttgc aaacgtcgtg acggttggcg gcgcgaaccg tttgacgaca       900
     ggcaaggcgc ttccgggaac agatccaaat caaaagattt tatacacatc catttacagc       960
     agtgccgata tgattgtcat gaattactta tcaagattag atggtgctag aaacgttcaa      1020
     atccatggcg ttggacacat cggccttctg tacagcagcc aagtcaacag cctgattaaa      1080
     gaagggctga acggcggggg ccagaatacg aattaatgaa aaacaaaacc ttgaagaatg      1140
     ctattcttca aggttattct gctttcagca caatggtttt cgcagccata tcatgaacgg      1200
     tttgtttttt cttcgtaaat gcggcagtca aatagatcag gcgggagaac acatgcaccc      1260
     acgctatcag gtaacggaca atggcttgcg ggaaggatat ttttttatat gtttcgtccc      1320
     tcacgatttg cagcccgatg ctttttttgc ccagtgtgcc cttccaattt gtcagcggca      1380
     tcagcaaaaa atacacaatc agcatcaata tggcgacaat aatgacaccg gcggacccat      1440
     cgccaaacgt aaatccggct gccaaaatca ctgctgcgca atgattacat caagt           1495
//

If you have problems or comments...

PBIL Back to PBIL home page