(data stored in SCRATCH zone)

EMBL: M79311

ID   M79311; SV 1; linear; mRNA; STD; MUS; 147 BP.
XX
AC   M79311;
XX
DT   04-JUN-1992 (Rel. 32, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus GTP-binding protein RAB5b mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-147
RX   DOI; 10.1016/0378-1119(92)90387-5.
RX   PUBMED; 1555775.
RA   Chavrier P., Simons K., Zerial M.;
RT   "The complexity of the Rab and Rho GTP-binding protein subfamilies revealed
RT   by a PCR cloning approach";
RL   Gene 112(2):261-264(1992).
XX
DR   MD5; b0fdce39e28eb86f1ead79cfbdbe0d52.
DR   Ensembl-Gn; ENSMUSG00000000711; mus_musculus.
DR   Ensembl-Gn; MGP_AKRJ_G0017815; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017816; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017639; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017200; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017609; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017715; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017710; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017738; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018311; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016985; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017259; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000727; mus_musculus.
DR   Ensembl-Tr; MGP_AKRJ_T0027471; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027484; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027292; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026888; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027221; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027344; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027329; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027320; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028015; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026594; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026811; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..147
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..>147
FT                   /codon_start=1
FT                   /product="GTP-binding protein RAB5b"
FT                   /db_xref="GOA:P61021"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:105938"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61021"
FT                   /protein_id="AAK14835.1"
FT                   /translation="GKSSLVLRFVKGQFHEYQESTIGAGFLTQSVCLDDTTVKFEIWDT
FT                   AGQE"
XX
SQ   Sequence 147 BP; 42 A; 33 C; 39 G; 33 T; 0 other;
     gggaagtcta gcctggtgtt acgttttgtc aaaggacagt tccatgaata ccaggaaagc        60
     accattggag cgggcttcct cacccaatcc gtgtgtttag atgacacaac agtcaagttt       120
     gagatctggg acacagcagg ccaagaa                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page