(data stored in ACNUC8465 zone)

EMBL: M79315

ID   M79315; SV 1; linear; mRNA; STD; MUS; 105 BP.
XX
AC   M79315;
XX
DT   04-JUN-1992 (Rel. 32, Created)
DT   06-MAR-2001 (Rel. 67, Last updated, Version 3)
XX
DE   Mus musculus GTP-binding protein RHO mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-105
RX   DOI; 10.1016/0378-1119(92)90387-5.
RX   PUBMED; 1555775.
RA   Chavrier P., Simons K., Zerial M.;
RT   "The complexity of the Rab and Rho GTP-binding protein subfamilies revealed
RT   by a PCR cloning approach";
RL   Gene 112(2):261-264(1992).
XX
DR   MD5; f539bb945a94a71dc9e71377e7e00e90.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..105
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..>105
FT                   /codon_start=1
FT                   /product="GTP-binding protein RHO"
FT                   /db_xref="GOA:Q99JI5"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:108446"
FT                   /db_xref="UniProtKB/TrEMBL:Q99JI5"
FT                   /protein_id="AAK14824.1"
FT                   /translation="FPESYRPTVFERYNATLQMKGKPVHLQIWDTAGQE"
XX
SQ   Sequence 105 BP; 32 A; 29 C; 25 G; 19 T; 0 other;
     ttcccagaga gctacagacc cacagtgttt gagcgctata atgccactct gcagatgaag        60
     ggtaaacctg tgcacctcca aatctgggac acagcaggcc aagaa                       105
//

If you have problems or comments...

PBIL Back to PBIL home page