(data stored in SCRATCH zone)

GenBank: AF047479

LOCUS       AF047479                8298 bp    DNA     linear   BCT 14-JUL-2017
DEFINITION  Plasmid NR79 transposon Tn2424 DNA integrase (intI1),
            aminoglycoside 3''-O-nucleotidyltransferase (aadA3), aminoglycoside
            6'-N-acetyltransferase (aacA1), chloramphenicol acetyltransferase
            (catB2), ethidium bromide resistance protein (qacEdelta1), and
            dihydropteroate synthase (sul1) genes, complete cds; and unknown
            gene.
ACCESSION   AF047479 M80188
VERSION     AF047479.2
KEYWORDS    .
SOURCE      Plasmid NR79
  ORGANISM  Plasmid NR79
            other sequences; plasmids.
REFERENCE   1  (bases 5614 to 8298)
  AUTHORS   Parent,R. and Roy,P.H.
  TITLE     The chloramphenicol acetyltransferase gene of Tn2424: a new breed
            of cat
  JOURNAL   J. Bacteriol. 174 (9), 2891-2897 (1992)
   PUBMED   1314803
REFERENCE   2  (bases 1 to 5613)
  AUTHORS   Gravel,A., Parent,R. and Roy,P.H.
  TITLE     Sequence analysis and cassette mobility of the In21 integron from
            transposon Tn2424
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 8298)
  AUTHORS   Gravel,A., Parent,R. and Roy,P.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-FEB-1998) Biochimie, Universite Laval, Pavillon
            Vachon, Quebec, PQ G1K 7P4, Canada
REFERENCE   4  (bases 1 to 8298)
  AUTHORS   Gravel,A., Parent,R. and Roy,P.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-NOV-2008) Biochimie, Universite Laval, Pavillon
            Vachon, Quebec, PQ G1K 7P4, Canada
  REMARK    Sequence update by submitter
COMMENT     On Nov 21, 2008 this sequence version replaced AF047479.1.
FEATURES             Location/Qualifiers
     source          1..8298
                     /organism="Plasmid NR79"
                     /plasmid=""
                     /mol_type="genomic DNA"
                     /host="Escherichia coli"
                     /db_xref="taxon:2468"
     mobile_element  1..8298
                     /mobile_element_type="transposon:Tn2424"
     misc_feature    <1..1286
                     /note="5'-conserved segment"
     gene            complement(137..1205)
                     /gene="intI1"
     CDS_pept        complement(137..1150)
                     /gene="intI1"
                     /note="tyrosine recombinase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA integrase"
                     /protein_id="AAC14727.1"
                     /translation="MKTATAPLPPLRSVKVLDQLRERIRYLHYSLRTEQAYVHWVRAF
                     IRFHGVRHPATLGSSEVEAFLSWLANERKVSVSTHRQALAALLFFYGKVLCTDLPWLQ
                     EIGRPRPSRRLPVVLTPDEVVRILGFLEGEHRLFAQLLYGTGMRISEGLQLRVKDLDF
                     DHGTIIVREGKGSKDRALMLPESLAPSLREQLSRARAWWLKDQAEGRSGVALPDALER
                     KYPRAGHSWPWFWVFAQHTHSTDPRSGVVRRHHMYDQTFQRAFKRAVEQAGITKPATP
                     HTLRHSFATALLRSGYDIRTVQDLLGHSDVSTTMIYTHVLKVGGAGVRSPLDALPPLT
                     SER"
     gene            1035..5808
                     /gene="orfM"
     gene            1035..5365
                     /gene="orfL"
     gene            1035..5065
                     /gene="orfK"
     gene            1035..4632
                     /gene="orfJ"
     gene            1035..4343
                     /gene="orfI"
     gene            1035..3644
                     /gene="orfH"
     gene            1035..3174
                     /gene="orfG"
     gene            1035..2744
                     /gene="aacA1"
     gene            1035..2087
                     /gene="aadA3"
     regulatory      1035..1040
                     /regulatory_class="minus_35_signal"
                     /gene="aadA3"
                     /note="promoter for aadA3, aacA1, orfG, orfH, orfI, orfJ,
                     orfK, orfL, orfM"
     regulatory      1058..1063
                     /regulatory_class="minus_10_signal"
                     /gene="aadA3"
                     /note="promoter for aadA3, aacA1, orfG, orfH, orfI, orfJ,
                     orfK, orfL, orfM"
     regulatory      complement(1177..1182)
                     /regulatory_class="minus_10_signal"
                     /gene="intI1"
     regulatory      complement(1200..1205)
                     /regulatory_class="minus_35_signal"
                     /gene="intI1"
     misc_recomb     1223..1292
                     /note="attI1"
     misc_recomb     1287..6649
                     /note="integron variable region"
     misc_feature    1287..2142
                     /note="aadA3 cassette"
     CDS_pept        1296..2087
                     /gene="aadA3"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside 3''-O-nucleotidyltransferase"
                     /protein_id="AAC14728.1"
                     /translation="MRVAVTIEISNQLSEVLSVIERHLESTLLAVHLYGSAVDGGLKP
                     YSDIDLLVTVAVKLDETTRRALLNDLMEASAFPGESETLRAIEVTLVVHDDIIPWRYP
                     AKRELQFGEWQRNDILAGIFEPAMIDIDLAILLTKAREHSVALVGPAAEEFFDPVPEQ
                     DLFEALRETLKLWNSQPDWAGDERNVVLTLSRIWYSAITGKIAPKDVAADWAIKRLPA
                     QYQPVLLEAKQAYLGQKEDHLASRADHLEEFIHYVKGEITKVVGK"
     misc_recomb     2089..2148
                     /note="aadA3 59-base element"
     misc_feature    2143..3300
                     /note="aacA1-orfG cassette"
     CDS_pept        2187..2744
                     /gene="aacA1"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside 6'-N-acetyltransferase"
                     /protein_id="AAC14729.1"
                     /translation="MNYQIVNIAECSNYQLEAANILTEAFNDLGNNSWPDMTSATKEV
                     KECIESPNLCFGLLINNSLVGWIGLRPMYKETWELHPLVVRPDYQNKGIGKILLKELE
                     NRAREQGIIGIALGTDDEYYRTSLSLITITEDNIFDSIKNIKNINKHPYEFYQKNGYY
                     IVGIIPNANGKNKPDIWMWKSLIKE"
     CDS_pept        2749..3174
                     /gene="orfG"
                     /codon_start=1
                     /transl_table=11
                     /product="unknown"
                     /protein_id="AAC14730.1"
                     /translation="MEQINNIELVDPSIYPTDEILKRILGKSFSVYLKLLRLYENYSL
                     IPEWKYYKDGKAWLCKVIKGKKTIVWMSAWKNYIKATIYLPEKHINGVLVLDIHEITK
                     KAFIETNNIGRSRPCMFELKEENILEDFIKVMQFKMTLK"
     misc_recomb     3189..3306
                     /note="aacA1-orfG 59-base element"
     misc_feature    3301..3752
                     /note="orfH cassette"
     CDS_pept        3312..3644
                     /gene="orfH"
                     /codon_start=1
                     /transl_table=11
                     /product="unknown"
                     /protein_id="AAC14731.1"
                     /translation="MGNFIKTLVCVVSAIFAVLAIDALISGNVRDSITLLVISAFVAL
                     CGGIGLFFQRFPSPPLAPGEGNSAWTLLRSYRKQYPGWQGKLVYYGIPTLLLIVMLFR
                     LSELLASI"
     misc_recomb     3673..3758
                     /note="orfH 59-base element"
     misc_feature    3753..4350
                     /note="orfI cassette"
     CDS_pept        3765..4343
                     /gene="orfI"
                     /codon_start=1
                     /transl_table=11
                     /product="unknown"
                     /protein_id="AAC14732.1"
                     /translation="MPRIFTQLIALLLLVACKPESVPLNESFTCSENPIELEQISQLL
                     KNEHVPFTQETVLVDRVSFTSAGVKSVLPKGATCIFYSHKYSNITNKINKEVIDDFPP
                     IWGRATSWDDRNAQLVEKLSQHGIQTTRRVYRGKEWIAWPIEDVELAENILGFNEKMK
                     QYFKEQRLKMYAPNQALKAQPSATVDAASSAS"
     misc_recomb     4280..4356
                     /note="orfI 59-base element"
     misc_feature    4351..4726
                     /note="orfJ cassette"
     CDS_pept        4375..4632
                     /gene="orfJ"
                     /codon_start=1
                     /transl_table=11
                     /product="unknown"
                     /protein_id="AAC14733.1"
                     /translation="MHDFNGAQIFVGAKVKVLFIDQTIMNGLPSSEVNDINSMLGEIF
                     EVYEIDEYGQAWVEKWWHLDEGKSYSHSLGLSSTELELVEK"
     misc_recomb     4659..4732
                     /note="orfJ 59-base element"
     misc_feature    4727..5447
                     /note="orfK-orfL cassette"
     CDS_pept        4796..5065
                     /gene="orfK"
                     /codon_start=1
                     /transl_table=11
                     /product="unknown"
                     /protein_id="AAC14734.1"
                     /translation="MQVKFSEDVIPLSDLKINPGKVVNRTQDTQRPILLTSRGRGVAV
                     VQGLEDYERAAEELRFVKAVAQGLVDVREGSTVSLEDARKALGIE"
     CDS_pept        5066..5365
                     /gene="orfL"
                     /codon_start=1
                     /transl_table=11
                     /product="unknown"
                     /protein_id="AAC14735.1"
                     /translation="MELRIAESTRGDLQAIQEYYRAEGVPQIGDDFVAATLGHCEMLQ
                     RHPEAGRVVPEFNLDNIRELIHAPFRVVYLRQSTETVLIRIWCSERQLELPENEE"
     misc_recomb     5360..5453
                     /note="orfK-orfL 59-base element"
     misc_feature    5448..5910
                     /note="orfM cassette"
     CDS_pept        5545..5808
                     /gene="orfM"
                     /codon_start=1
                     /transl_table=11
                     /product="unknown"
                     /protein_id="AAC14736.1"
                     /translation="MQGGQLHGVADGAMRHAGDRVGQLQWPAELEQIVKFGVCRISLA
                     GLLLANLVTWQQPDAFYWPVPDNVFLVTQGGSSENNLPRSMVL"
     gene            5803..6589
                     /gene="catB2"
     misc_recomb     5803..5916
                     /note="orfM 59-base element"
     regulatory      5803..5808
                     /regulatory_class="minus_35_signal"
                     /gene="catB2"
                     /note="putative"
     regulatory      5826..5831
                     /regulatory_class="minus_10_signal"
                     /gene="catB2"
                     /note="putative"
     misc_feature    5911..6649
                     /note="catB2 cassette"
     regulatory      5944..5947
                     /regulatory_class="ribosome_binding_site"
                     /gene="catB2"
     CDS_pept        5957..6589
                     /gene="catB2"
                     /codon_start=1
                     /transl_table=11
                     /product="chloramphenicol acetyltransferase"
                     /protein_id="AAC14737.2"
                     /translation="MTNYFESPFKGKLLTEQVKNPNIKVGRYSYYSGYYHGHSFDDCA
                     RYLLPDRDDVDQLIIGSFCSIGSGAAFIMAGNQGHRYDWVSSFPFFYMNEEPAFAKSV
                     DAFQRAGDTVIGSDVWIGSEAMIMPGIKIGHGAVIGSRALVAKDVEPYTIVGGNPAKS
                     IRKRFSEEEISMLLDMAWWDWPLEQIKEAMPFLCSSGIASLYRRWQGTSA"
     misc_recomb     6584..6655
                     /note="catB2 59-base element"
     misc_feature    6650..>8298
                     /note="3'-conserved segment"
     gene            6700..7938
                     /gene="sul1"
     gene            6700..7105
                     /gene="qacEdelta1"
     regulatory      6700..6705
                     /regulatory_class="minus_35_signal"
                     /gene="qacEdelta1"
                     /note="promoter for qacEdelta1 and sul1; putative"
     regulatory      6724..6729
                     /regulatory_class="minus_10_signal"
                     /gene="qacEdelta1"
                     /note="promoter for qacEdelta1 and sul1; putative"
     regulatory      6747..6750
                     /regulatory_class="ribosome_binding_site"
                     /gene="qacEdelta1"
     CDS_pept        6758..7105
                     /gene="qacEdelta1"
                     /codon_start=1
                     /transl_table=11
                     /product="ethidium bromide resistance protein"
                     /protein_id="AAC14738.1"
                     /translation="MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAF
                     YFLSLVLKSIPVGVAYAVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIIAAFLLAR
                     SPSWKSLRRPTPW"
     regulatory      7086..7089
                     /regulatory_class="ribosome_binding_site"
                     /gene="sul1"
     CDS_pept        7099..7938
                     /gene="sul1"
                     /note="sulphonamide resistance"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="AAC14739.1"
                     /translation="MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDV
                     GPAASHPDARPVSPADEIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLND
                     IQGFPDPALYPDIAEADCRLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSAL
                     RRSGVAADRLILDPGMGFFLSPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGAT
                     VGLPVKDLGPASLAAELHAIGNGADYVRTHAPGDLRSAITFSETLAKFRSRDARDRGL
                     DHA"
     gene            8010..>8298
                     /gene="orf5"
     regulatory      8010..8015
                     /regulatory_class="minus_35_signal"
                     /gene="orf5"
                     /note="putative"
     regulatory      8030..8035
                     /regulatory_class="minus_10_signal"
                     /gene="orf5"
                     /note="putative"
     regulatory      8059..8062
                     /regulatory_class="ribosome_binding_site"
                     /gene="orf5"
     CDS_pept        8066..>8298
                     /gene="orf5"
                     /codon_start=1
                     /transl_table=11
                     /product="unknown"
                     /protein_id="AAC14740.1"
                     /translation="MDSEEPPNVRVACSGDIDEVVRLMHDAAAWMSAKGTPAWDVARI
                     DRTFAETFVLRSELLVASCSDGIVGCCTLSAEDP"
ORIGIN
        1 ggatccatca ggcaacgacg ggctgctgcc ggccatcagc ggacgcaggg aggactttcc
       61 gcaaccggcc gttcgatgcg gcaccgatgg ccttcgcgca ggggtagtga atccgccagg
      121 attgacttgc gctgccctac ctctcactag tgaggggcgg cagcgcatca agcggtgagc
      181 gcactccggc accgccaact ttcagcacat gcgtgtaaat catcgtcgta gagacgtcgg
      241 aatggccgag cagatcctgc acggttcgaa tgtcgtaacc gctgcggagc aaggccgtcg
      301 cgaacgagtg gcggagggtg tgcggtgtgg cgggcttcgt gatgcctgct tgttctacgg
      361 cacgtttgaa ggcgcgctga aaggtctggt catacatgtg atggcgacgc acgacaccgc
      421 tccgtggatc ggtcgaatgc gtgtgctgcg caaaaaccca gaaccacggc caggaatgcc
      481 cggcgcgcgg atacttccgc tcaagggcgt cgggaagcgc aacgccgctg cggccctcgg
      541 cctggtcctt cagccaccat gcccgtgcac gcgacagctg ctcgcgcagg ctgggtgcca
      601 agctctcggg taacatcaag gcccgatcct tggagccctt gccctcccgc acgatgatcg
      661 tgccgtgatc gaaatccaga tccttgaccc gcagttgcaa accctcactg atccgcatgc
      721 ccgttccata cagaagctgg gcgaacaaac gatgctcgcc ttccagaaaa ccgaggatgc
      781 gaaccacttc atccggggtc agcaccaccg gcaagcgccg cgacggccga ggtcttccga
      841 tctcctgaag ccagggcaga tccgtgcaca gcaccttgcc gtagaagaac agcaaggccg
      901 ccaatgcctg acgatgcgtg gagaccgaaa ccttgcgctc gttcgccagc caggacagaa
      961 atgcctcgac ttcgctgctg cccaaggttg ccgggtgacg cacaccgtgg aaacggatga
     1021 aggcacgaac ccagtggaca taagcctgtt cggttcgtaa actgtaatgc aagtagcgta
     1081 tgcgctcacg caactggtcc agaaccttga ccgaacgcag cggtggtaac ggcgcagtgg
     1141 cggttttcat ggcttgttat gactgttttt ttgtacagtc tatgcctcgg gcatccaagc
     1201 agcaagcgcg ttacgccgtg ggtcgatgtt tgatgttatg gagcagcaac gatgttacgc
     1261 agcagggcag tcgccctaaa acaaagttag acatcatgag ggtagcggtg accatcgaaa
     1321 tttcgaacca actatcagag gtgctaagcg tcattgagcg ccatctggaa tcaacgttgc
     1381 tggccgtgca tttgtacggc tccgcagtgg atggcggcct gaagccatac agcgatattg
     1441 atttgttggt tactgtggcc gtaaagcttg atgaaacgac gcggcgagca ttgctcaatg
     1501 accttatgga ggcttcggct ttccctggcg agagcgagac gctccgcgct atagaagtca
     1561 cccttgtcgt gcatgacgac atcatcccgt ggcgttatcc ggctaagcgc gagctgcaat
     1621 ttggagaatg gcagcgcaat gacattcttg cgggtatctt cgagccagcc atgatcgaca
     1681 ttgatctagc tatcctgctt acaaaagcaa gagaacatag cgttgccttg gtaggtccgg
     1741 cagcggagga attctttgac ccggttcctg aacaggatct attcgaggcg ctgagggaaa
     1801 ccttgaagct atggaactcg cagcccgact gggccggcga tgagcgaaat gtagtgctta
     1861 cgttgtcccg catttggtac agcgcaataa ccggcaaaat cgcgccgaag gatgtcgctg
     1921 ccgactgggc aataaaacgc ctacctgccc agtatcagcc cgtcttactt gaagctaagc
     1981 aagcttatct gggacaaaaa gaagatcact tggcctcacg cgcagatcac ttggaagaat
     2041 ttattcacta cgtgaaaggc gagatcacca aggtagtcgg caaataatgt ctaacaattc
     2101 gttcaagccg acgccgcttc gcggcgcggc ttaactcaag cgttagggcg acgccgctat
     2161 tgcggcgcga atacaaagag gaagagatga attatcaaat tgtgaatatt gcggaatgca
     2221 gcaattatca gttagaagca gcaaatatac taacagaagc gttcaatgat cttggtaaca
     2281 attcatggcc agatatgacg agtgcaacaa aagaagtaaa agaatgtatt gagagtccaa
     2341 acctttgttt cggtctgcta ataaataact ccttagttgg ctggataggc ttaaggccaa
     2401 tgtacaagga aacctgggaa ttgcatccat tggttgtcag accagattat caaaataaag
     2461 gtattggcaa gatcctgctt aaggaattag aaaacagagc tagagagcaa ggtattattg
     2521 gaatcgcttt aggaacagat gatgaatact atagaacaag tctctcttta ataactataa
     2581 cagaagataa tatatttgat tcaataaaaa atattaaaaa tattaataaa catccatatg
     2641 agttttatca gaagaatggt tattatattg ttggaataat tccaaatgcc aatggtaaaa
     2701 acaaaccaga tatttggatg tggaaaagtt taatcaaaga gtaaaacaat ggaacagatt
     2761 aataacatag aacttgtaga tccatctatc tacccaacag atgaaatctt aaaaagaata
     2821 cttggaaaat cgtttagtgt atatttaaaa ttactacgac tctatgaaaa ttatagttta
     2881 ataccagagt ggaagtatta taaagatgga aaagcttggt tatgtaaagt tataaaggga
     2941 aagaaaacga ttgtttggat gtctgcatgg aagaactaca taaaagctac tatatatctt
     3001 ccagaaaaac atattaacgg tgtattagta ttagatattc atgagattac aaagaaagca
     3061 tttatagaga caaataatat tggaagatca aggccttgca tgtttgaatt aaaagaagaa
     3121 aatatattag aagatttcat aaaggtaatg cagttcaaaa tgacattaaa atgatcaacc
     3181 gaaatttgcc ctaacaaatg cttcaacctg acaattcctg ttgtcatggt ttgtgctgtc
     3241 gctttgctca gcacaaacca cgccaagccc ttcgggccgg aattgcaggt taagcaaatg
     3301 ttaggcaaca catgggcaat ttcatcaaaa cgctggtttg tgtcgtttct gcaatctttg
     3361 cagtcctagc gattgatgct ctcatctccg gcaacgtaag ggatagcatc actttgcttg
     3421 ttatttcagc atttgtcgct ttgtgtggtg gtattggctt gttttttcag cgtttcccgt
     3481 ctccgcctct cgctcccggc gagggcaata gcgcatggac tctccttagg agctatcgca
     3541 agcaataccc agggtggcaa ggcaagctgg tttattatgg catccccaca ctgttattaa
     3601 ttgtgatgct ttttcgcttg tctgagcttt tggcttccat ctgaaatact gtggccacat
     3661 aatgaacact ctgcctaacc tggcctcaac ctcgctccct tcagttgctg gacgctgcgc
     3721 gataaggccg cgcagcgccg gttagctcta cgttaggtgc acacatgcca agaattttta
     3781 ctcaactcat agcgttactt ctattggttg cgtgcaaacc tgaatctgta ccgcttaatg
     3841 aatcatttac ctgttctgaa aaccccatcg aattagaaca gatctcacaa ctattgaaaa
     3901 atgagcatgt gccattcact caagaaacag ttttggtcga cagggtatca tttacttcag
     3961 cgggcgtaaa aagtgttctc cctaaggggg ctacgtgcat tttctactca cataaataca
     4021 gcaatattac gaataaaatt aacaaagaag tcattgatga ctttccgcca atctggggta
     4081 gagctacctc ttgggacgat cgaaacgccc aattggttga aaaattatcg caacacggca
     4141 tccagacaac aaggcgcgtt tatagaggta aagaatggat cgcatggccc atagaagatg
     4201 tcgagttggc cgaaaatatt ttaggcttca atgagaaaat gaaacagtat tttaaagagc
     4261 agcggcttaa aatgtatgca cctaaccagg cgctcaaggc gcagccttcg gctaccgtgg
     4321 acgccgcaag cagcgcctct tagctctacg ttaacttgag gggaattaaa catcgtgcat
     4381 gattttaacg gtgcacaaat ctttgttggg gctaaagtta aagttctatt tattgatcaa
     4441 acgattatga atggactgcc atcaagcgaa gtaaatgaca ttaattctat gctgggtgaa
     4501 atattcgaag tttacgaaat agacgaatat ggccaagcat gggttgaaaa gtggtggcat
     4561 ttagatgaag gtaaatcgta ttcgcactct ttaggcttgt cctcaacaga gcttgagtta
     4621 gtagaaaaat aaaccaacaa tagtgcattt aagtcaaaag ttaacaaggc gctccagcaa
     4681 tgcgcacttt gtgcgctcga cttataaact gcggctgagc ttagcgttat gcttcttgac
     4741 cgcacctgtt aacgggtgct attgatggtg ccggtttatt gattggatta ttaccatgca
     4801 agtgaaattt tccgaagatg tcattcctct gtcagatctg aagatcaatc ccggaaaggt
     4861 ggttaatcgc acgcaggata cacaacggcc aatcctgctt accagtcgtg gccgcggtgt
     4921 tgctgttgtt caggggcttg aggattatga gagagccgca gaggaattgc ggtttgtcaa
     4981 agcggtggcg caggggctgg tggatgttcg cgagggcagc accgtttcgt tggaggacgc
     5041 gaggaaagcg ttgggcatcg agtaaatgga attacgcatc gcagagtcca ctcgtggtga
     5101 tttacaggct attcaggaat attacagagc agagggtgtg ccgcagatcg gtgatgattt
     5161 tgtggcagcc accctcgggc attgtgagat gcttcaacgc caccctgaag caggccgtgt
     5221 tgtccctgag ttcaatctgg ataatattcg tgaattgatt catgcaccat ttcgggttgt
     5281 ttacctcagg cagtctaccg agactgtgct catccggatc tggtgtagtg agaggcagct
     5341 tgaattacca gaaaacgaag aataaccagt caatagcccc cgctcctgca gaaacagagg
     5401 gtgtttcatg aaccaccccg ggcaccagcc gttttggcgg caacaagtta aacagcatca
     5461 ttcatcgggc ttttgccttg atgcggcaaa ggcttgcaga taggtcactg gcagattcct
     5521 gaacagctga tactgctcca gcaggtgcag ggtggtcagc ttcatggtgt tgcggatggg
     5581 gcgatgcggc acgcgggtga cagggttggc cagctgcagt ggccggccga gctggaacag
     5641 atagtaaagt tcggtgtttg ccggatcagc cttgccggcc tgttgctcgc taatctggtt
     5701 acgtggcaac aacctgacgc tttttactgg ccagtgccag ataatgtttt cctggttacg
     5761 caaggcgggt caagcgaaaa taatctacca agaagtatgg tcttgtaacg ggttgatccc
     5821 tatggtctaa tcgggcaatc aaaatttagt cgcatcgggt tataccgcct tcacgatgat
     5881 tggcttatgt agaaggcggt ctaatacatg ttaggcgacg cgtggagtcg ctctagaatt
     5941 ttcgggtaca aattttatga cgaattattt tgagagtccc ttcaaaggga agcttctgac
     6001 tgagcaggtg aagaatccga acatcaaggt agggcggtat agctactatt ccggctatta
     6061 ccatgggcac tcgtttgatg attgtgctcg ctaccttcta ccagaccgtg atgacgttga
     6121 tcagctgatt atcggcagct tctgctccat cggatcaggc gcagctttta ttatggctgg
     6181 gaatcaaggc caccgatatg attgggtctc ttctttccct ttcttctaca tgaacgagga
     6241 gcccgcgttt gcaaaatcag tcgatgcatt ccagcgggct ggcgacacag ttataggaag
     6301 tgatgtgtgg atcggttcgg aggccatgat catgcccggg atcaagatcg ggcatggagc
     6361 ggtgataggt agccgcgctt tggttgccaa agacgtggaa ccctacacca tagtgggggg
     6421 aaaccctgca aagtcgatta ggaagcgctt ttctgaagaa gaaatttcta tgcttttaga
     6481 tatggcttgg tgggattggc cgctggaaca aatcaaggaa gcaatgcctt ttctttgttc
     6541 gtctggcatt gccagcctgt atcgtcgctg gcaaggcaca agcgcctaac aatacgctac
     6601 acacggacaa attacccgtt gcgctcctaa tttgccggtg agcgtggcgt tagatgcact
     6661 aagcacataa ttgctcacag ccaaactatc aggtcaagtc tgcttttatt atttttaagc
     6721 gtgcataata agccctacac aaattgggag atatatcatg aaaggctggc tttttcttgt
     6781 tatcgcaata gttggcgaag taatcgcaac atccgcatta aaatctagcg agggctttac
     6841 taagcttgcc ccttccgccg ttgtcataat cggttatggc atcgcatttt attttctttc
     6901 tctggttctg aaatccatcc ctgtcggtgt tgcttatgca gtctggtcgg gactcggcgt
     6961 cgtcataatt acagccattg cctggttgct tcatgggcaa aagcttgatg cgtggggctt
     7021 tgtaggtatg gggctcataa ttgctgcctt tttgctcgcc cgatccccat cgtggaagtc
     7081 gctgcggagg ccgacgccat ggtgacggtg ttcggcattc tgaatctcac cgaggactcc
     7141 ttcttcgatg agagccggcg gctagacccc gccggcgctg tcaccgcggc gatcgaaatg
     7201 ctgcgagtcg gatcagacgt cgtggatgtc ggaccggccg ccagccatcc ggacgcgagg
     7261 cctgtatcgc cggccgatga gatcagacgt attgcgccgc tcttagacgc cctgtccgat
     7321 cagatgcacc gtgtttcaat cgacagcttc caaccggaaa cccagcgcta tgcgctcaag
     7381 cgcggcgtgg gctacctgaa cgatatccaa ggatttcctg accctgcgct ctatcccgat
     7441 attgctgagg cggactgcag gctggtggtt atgcactcag cgcagcggga tggcatcgcc
     7501 acccgcaccg gtcaccttcg acccgaagac gcgctcgacg agattgtgcg gttcttcgag
     7561 gcgcgggttt ccgccttgcg acggagcggg gtcgctgccg accggctcat cctcgatccg
     7621 gggatgggat ttttcttgag ccccgcaccg gaaacatcgc tgcacgtgct gtcgaacctt
     7681 caaaagctga agtcggcgtt ggggcttccg ctattggtct cggtgtcgcg gaaatccttc
     7741 ttgggcgcca ccgttggcct tcctgtaaag gatctgggtc cagcgagcct tgcggcggaa
     7801 cttcacgcga tcggcaatgg cgctgactac gtccgcaccc acgcgcctgg agatctgcga
     7861 agcgcaatca ccttctcgga aaccctcgcg aaatttcgca gtcgcgacgc cagagaccga
     7921 gggttagatc atgcctagca ttcaccttcc ggccgcccgc tagcggaccc tggtcaggtt
     7981 ccgcgaaggt gggcgcagac atgctgggct cgtcaggatc aaactgcact atgaggcggc
     8041 ggttcatacc gcgccagggg agcgaatgga cagcgaggag cctccgaacg ttcgggtcgc
     8101 ctgctcgggt gatatcgacg aggttgtgcg gctgatgcac gacgctgcgg cgtggatgtc
     8161 cgccaaggga acgcccgcct gggacgtcgc gcggatcgac cggacattcg cggagacctt
     8221 cgtcctgaga tccgagctcc tagtcgcgag ttgcagcgac ggcatcgtcg gctgttgcac
     8281 cttgtcggcc gaggatcc
//

If you have problems or comments...

PBIL Back to PBIL home page