(data stored in ACNUC27125 zone)

EMBL: M81475

ID   M81475; SV 1; linear; mRNA; STD; MUS; 1964 BP.
XX
AC   M81475;
XX
DT   26-JAN-1992 (Rel. 30, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Murine phosphoprotein phosphatase mRNA, complete cds.
XX
KW   phosphoprotein phosphatase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RX   PUBMED; 2162844.
RA   Kincaid R.L., Giri P.R., Higuchi S., Tamura J., Dixon S.C., Marietta C.A.,
RA   Amorese D.A., Martin B.M.;
RT   "Cloning and characterization of molecular isoforms of the catalytic
RT   subunit of calcineurin using nonisotopic methods";
RL   J Biol Chem 265(19):11312-11319(1990).
XX
RN   [2]
RX   DOI; 10.1016/S0006-291X(05)81410-X.
RX   PUBMED; 1659808.
RA   Giri P.R., Higuchi S., Kincaid R.L.;
RT   "Chromosomal mapping of the human genes for the calmodulin-dependent
RT   protein phosphatase (calcineurin) catalytic subunit";
RL   Biochem. Biophys. Res. Commun. 181(1):252-258(1991).
XX
RN   [3]
RP   1-1964
RX   DOI; 10.1073/pnas.89.2.529.
RX   PUBMED; 1309945.
RA   Muramatsu T., Giri P.R., Higuchi S., Kincaid R.L.;
RT   "Molecular cloning of a calmodulin-dependent phosphatase from murine
RT   testis: identification of a developmentally expressed nonneural isoenzyme";
RL   Proc. Natl. Acad. Sci. U.S.A. 89(2):529-533(1992).
XX
DR   MD5; 676216dbc3831d2de28780599c7c6072.
DR   Ensembl-Gn; ENSMUSG00000022092; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021534; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021493; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021469; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021499; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021276; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021938; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020793; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021243; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021366; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021345; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021437; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021374; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021962; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020537; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020846; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000078434; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0040026; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0039993; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0039947; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0039992; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0039733; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0040468; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0039740; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0039649; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0039794; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0039761; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0039872; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0039755; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0040505; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0039348; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0039124; mus_musculus_wsbeij.
DR   EuropePMC; PMC22815; 9770470.
XX
CC   citation [2] (bases 1-1800)
CC   citation [3] (bases 1-1964).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1964
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="10-12 weeks"
FT                   /cell_type="mixed germ cells"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..216
FT   CDS_pept        217..1758
FT                   /codon_start=1
FT                   /standard_name="calcineurin"
FT                   /product="phosphoprotein phosphatase"
FT                   /function="catalytic subunit of calmodulin-dependent
FT                   phosphatase"
FT                   /note="derived from a third murine gene for the catalytic
FT                   subunit (type 3), its deduced sequence is 81% identical to
FT                   that of type 1 gene (ref. 2) and 77% identical to type 2
FT                   gene (ref. 3)"
FT                   /db_xref="GOA:P48455"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="MGI:MGI:107162"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48455"
FT                   /protein_id="AAA39968.1"
FT                   /translation="MSVRRPQFSTTERVIKAVPFPPTRRLTLKEVFENGKPKMDLLKNH
FT                   LVKEGRVEEEVALKIINDGAAILKQEKTMIEVEAPITVCGDVHGQFFDLMKLFEVGGSP
FT                   SNTRYLFLGDYVDRGYFSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECR
FT                   IKYSEMVYDACMHTFDCLPLAALLNQQFLCVHGGMSPEITCLEDIRKLDRFSEPPAFGP
FT                   VCDLLWSDPLEDYGSEKTLEHYTHNTVRGCSYFFSYPAVCEFLQNNSLLSIIRAHEAQD
FT                   AGYRMYRKNQATGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLP
FT                   NFMDVFTWSLPFVGEKVTEMLVNILNICSDEEMNVTDEEGATTGRKEVIKNKIRAIGKM
FT                   ARVFTVLREESENVLTLKGLTPTGTLPLGVLSGGKQTIETAKQEAAEEREAIRGFTIAH
FT                   RIRSFEEARGLDRINERMPPRKEASYHHDAGRMHSHSHPPHPQASRRTDHGKKAL"
FT   3'UTR           1759..1964
FT   polyA_site      1915..1920
XX
SQ   Sequence 1964 BP; 541 A; 467 C; 494 G; 462 T; 0 other;
     gttgtgtccc tcagccgcgg tcgccgtagc tctcgacgcg gtcgtccccg ccgagccgcg        60
     gcgccgccgc agggagggag cggcgctgcg gcccgccgcg tccgaggacg ccccgtattc       120
     cggggccggc acgtggctgc cgctcgccga gcgcagcccg cctaggagga aggcggcggc       180
     ttgcgtccag cgggccgccg gagccgggag gagaccatgt ccgtgaggcg ccctcagttc       240
     tccacgaccg agcgcgtcat caaagctgtc ccctttcctc caacccgacg gctaactttg       300
     aaggaagttt ttgagaatgg gaaacctaaa atggatcttt tgaaaaacca tttagtaaaa       360
     gaaggtcggg tggaagagga ggtggcctta aagatcatca atgatggggc tgccatcctg       420
     aagcaggaga agaccatgat agaggtggag gctccgatca cagtgtgtgg tgatgttcat       480
     ggacaattct ttgacctgat gaagttgttt gaagttgggg gatcacctag taatactcgc       540
     tacctcttcc tgggtgacta tgtggacaga ggctatttca gtatagagtg tgtgctgtat       600
     ctatggagct taaagattaa ccatcctaaa acattgtttc tgcttcgagg aaatcatgaa       660
     tgcaggcatc ttacagagta cttcaccttc aaacaggaat gtcggatcaa gtattcagag       720
     atggtgtacg atgcgtgcat gcacactttc gactgtcttc ctcttgctgc cctcttaaac       780
     cagcagtttc tctgtgtaca tggaggaatg tctcctgaaa ttacttgttt agaggacatt       840
     aggaaattag ataggttttc tgagcctcct gcttttgggc cagtgtgtga cctgctgtgg       900
     tctgatccct tagaggacta cggcagcgag aagaccctgg agcactatac ccacaacact       960
     gtccgaggct gctcctactt cttcagttac cctgcagttt gtgaattttt acagaacaac      1020
     agtttattat caataatcag agcccatgaa gcccaggatg cggggtaccg aatgtatagg      1080
     aagaaccaag caactggctt tccgtcactt attacgattt tctctgcccc taattaccta      1140
     gatgtctata acaataaagc tgcagtgttg aagtatgaaa acaatgtcat gaacatcagg      1200
     cagttcaact gttccccaca cccctactgg ctcccaaact tcatggatgt tttcacgtgg      1260
     tctttgcctt ttgttggaga gaaagtgaca gagatgctgg tcaatattct caacatatgc      1320
     tcggatgaag aaatgaacgt aaccgatgaa gaaggagcta ctacaggtcg aaaagaagtc      1380
     atcaagaata aaatccgagc cattgggaaa atggcccggg tctttacggt tcttcgggaa      1440
     gagagtgaga atgtgctgac cctcaagggc ctcactccca caggcacact cccactgggg      1500
     gtcctctctg gaggaaagca gaccattgag actgccaaac aagaagccgc agaggagcgg      1560
     gaagccatca gaggttttac aattgcacac aggatccgaa gttttgaaga agcccgaggt      1620
     ctagaccgaa ttaatgagag aatgccaccc cgaaaagagg cttcatatca tcatgatgca      1680
     gggaggatgc actcacactc gcatccgcca cacccacagg cgtcaagaag gaccgaccat      1740
     ggaaagaaag ccctgtaatg actcagggcc ctgtgcagca cagatgggtc ccaaccctat      1800
     gagcaaatca catttattta tactggaaat gaaacaggaa caactcaaac aacttaaact      1860
     tggaggtgca tttgtaattc agtcgcattt attctgtaag aaaaatgacc attttataaa      1920
     ttcttctaat ttatgttcaa tataaaaaaa aaaaaaaaaa aaaa                       1964
//

If you have problems or comments...

PBIL Back to PBIL home page