(data stored in ACNUC27125 zone)

EMBL: M81483

ID   M81483; SV 1; linear; mRNA; STD; MUS; 1800 BP.
XX
AC   M81483;
XX
DT   03-FEB-1992 (Rel. 30, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus calmodulin dependent phosphatase catalytic subunit (Cam-Prp)
DE   mRNA, 3' end.
XX
KW   calcineurin; calmodulin-dependent protein phosphatase;
KW   phosphoprotein phosphatase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1800
RX   DOI; 10.1073/pnas.86.23.9183.
RX   PUBMED; 2556704.
RA   Guerini D., Klee C.B.;
RT   "Cloning of human calcineurin A: evidence for two isozymes and
RT   identification of a polyproline structural domain";
RL   Proc. Natl. Acad. Sci. U.S.A. 86(23):9183-9187(1989).
XX
RN   [2]
RP   1-1800
RX   PUBMED; 2162844.
RA   Kincaid R.L., Giri P.R., Higuchi S., Tamura J., Dixon S.C., Marietta C.A.,
RA   Amorese D.A., Martin B.M.;
RT   "Cloning and characterization of molecular isoforms of the catalytic
RT   subunit of calcineurin using nonisotopic methods";
RL   J Biol Chem 265(19):11312-11319(1990).
XX
RN   [3]
RX   DOI; 10.1016/S0006-291X(05)81410-X.
RX   PUBMED; 1659808.
RA   Giri P.R., Higuchi S., Kincaid R.L.;
RT   "Chromosomal mapping of the human genes for the calmodulin-dependent
RT   protein phosphatase (calcineurin) catalytic subunit";
RL   Biochem. Biophys. Res. Commun. 181(1):252-258(1991).
XX
DR   MD5; f0cd9a95234588db92586f829374c131.
DR   Ensembl-Gn; ENSMUSG00000021816; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021038; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020987; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020964; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020990; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020774; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021423; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020298; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020740; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020863; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020846; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020939; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020872; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021456; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020047; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020354; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000159027; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0038426; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0038383; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0038347; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0038388; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0038131; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038846; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0038133; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0038049; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0038194; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0038164; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0038312; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0038147; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038890; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037755; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037541; mus_musculus_wsbeij.
DR   EuropePMC; PMC2185582; 11062266.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1800
FT                   /organism="Mus musculus"
FT                   /strain="B6/CBAF1J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="6-8 weeks"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        1..1548
FT                   /partial
FT                   /codon_start=1
FT                   /gene="CaM-Prp"
FT                   /product="calmodulin dependent phosphatase catalytic
FT                   subunit"
FT                   /db_xref="GOA:P48453"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="MGI:MGI:107163"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48453"
FT                   /protein_id="AAA37411.1"
FT                   /translation="PPPPPPPPPPLGADRVVKAVPFPPTHRLTSEEVFDMDGIPRVDVL
FT                   KNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVG
FT                   GSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQ
FT                   ECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPA
FT                   FGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHE
FT                   AQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPY
FT                   WLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNK
FT                   IRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAI
FT                   RGFSPPHRICSFGEAKGLDRINERMPPRKDAVQQDGFNSLNTAHTTENHGTGNHTPQ"
XX
SQ   Sequence 1800 BP; 518 A; 361 C; 430 G; 491 T; 0 other;
     ccgcccccgc ccccgccccc accgccccct ctcggggccg accgcgtcgt caaagctgtt        60
     ccttttcccc caactcatcg gctgacatct gaagaagtgt ttgatatgga tgggataccc       120
     agggttgatg ttctgaagaa ccatctggta aaagaagggc gggtggatga agaaattgca       180
     ctaagaatta tcaatgaggg tgctgccata cttcggcggg agaaaaccat gatagaagta       240
     gaagctccaa ttacagtgtg tggtgacatc catggccaat tttttgatct gatgaaactt       300
     tttgaagtag gaggatcacc tgctaataca cgataccttt ttcttggtga ttatgtggac       360
     agaggttatt ttagtataga gtgtgtctta tatttatggg tcttgaagat tctataccca       420
     agcacattat tccttctgag aggcaaccat gaatgcagac accttactga atattttacc       480
     tttaagcagg aatgtaaaat taaatattca gaaagagtct atgaagcttg tatggaggct       540
     tttgacagct tgccccttgc tgcacttcta aaccaacaat ttctttgtgt tcatggtgga       600
     ctttcaccag aaatacacac actggatgat attaggagat tagatagatt taaagagcca       660
     cctgcatttg gaccaatgtg tgacttgcta tggtctgatc cttctgaaga ctttggaaat       720
     gaaaaatcac aagaacattt tagtcataat acagttcgag gatgttctta tttttataac       780
     tatccagcag tgtgtgaatt tttgcaaaac aataatttgt tatcgattat tagagctcat       840
     gaagctcaag atgcaggcta tagaatgtac agaaaaagtc aaactacagg gtttccttca       900
     ttaataacaa ttttttcggc acctaattac ttagatgtct acaataataa agctgctgta       960
     ctaaagtatg aaaataatgt gatgaacatt cgacagttta attgctctcc acatccttat      1020
     tggttgccca attttatgga tgtctttaca tggtctttac catttgttgg agaaaaagtg      1080
     acagaaatgt tggtaaatgt tctgagtatt tgttctgatg atgaactaat gacagaaggt      1140
     gaagaccagt ttgatgtagg ttcagctgca gcccggaaag aaatcataag aaacaagatc      1200
     cgagcaattg gcaagatggc aagagtcttc tctgttctca gggaggagag tgaaagcgtg      1260
     ctgacactca agggcctgac tcccacaggg atgttgccta gtggagtgtt ggctggagga      1320
     cggcagacct tgcaaagtgc cacagttgag gctattgagg ctgaaaaagc aatacgagga      1380
     ttctctccac cacatagaat ctgcagtttt ggagaggcaa agggtttgga taggatcaat      1440
     gagagaatgc caccccggaa agatgctgtg cagcaagatg gtttcaattc cctgaacacc      1500
     gcacatacca ctgagaacca cgggactggc aaccatactc cccagtgacc agcggcttcc      1560
     cagggactct cacatcttgg gccccaaatg gacagatcac ttcaaggagc tggaggggtt      1620
     gaccaaggtg atgataaatg tcataatctc tctgaagaaa ccattgtgct ttctgagatc      1680
     cgtgccccct tcctggatgg aggcttgagg gccctgggac ttgtgccgtc tataagattg      1740
     ggtaatcgct gccacagagg agagcagtga gcaaggggct tggggcaatt tccagtggag      1800
//

If you have problems or comments...

PBIL Back to PBIL home page