(data stored in SCRATCH zone)

EMBL: M81748

ID   M81748; SV 1; linear; genomic DNA; STD; PRO; 375 BP.
XX
AC   M81748;
XX
DT   04-MAY-1992 (Rel. 31, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 5)
XX
DE   Bacillus subtilis ribosomal protein L24 (rplX) gene, complete cds.
XX
KW   ribosomal protein L24; spc operon.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RX   DOI; 10.1093/nar/17.18.7469.
RX   PUBMED; 2508062.
RA   Henkin T.M., Moon S.H., Mattheakis L.C., Nomura M.;
RT   "Cloning and analysis of the spc ribosomal protein operon of Bacillus
RT   subtilis: comparison with the spc operon of Escherichia coli";
RL   Nucleic Acids Res. 17(18):7469-7486(1989).
XX
RN   [2]
RP   1-375
RX   PUBMED; 1556555.
RA   Sharp P.M., Nolan N.C., Ni Cholmain N., Devine K.M.;
RT   "DNA sequence variability at the rplX locus of Bacillus subtilis";
RL   J. Gen. Microbiol. 138(1):39-45(1992).
XX
DR   MD5; 45a4eb191f52615d389cda4803c7f217.
XX
CC   strain JH642 is a derivative of strain 168
CC   strains S322, S316, and BSG33-1 are identical to JH642.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..375
FT                   /organism="Bacillus subtilis"
FT                   /map="12 degrees"
FT                   /sub_species="Marburg"
FT                   /strain="168"
FT                   /sub_strain="JH642"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   variation       1..2
FT                   /gene="rplX"
FT                   /replace="ttt"
FT                   /product="ribosomal protein L24"
FT                   /note="found in strain S032"
FT   gene            1..349
FT                   /gene="rplX"
FT   CDS_pept        38..349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /product="ribosomal protein L24"
FT                   /db_xref="GOA:P0CI78"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CI78"
FT                   /protein_id="AAB59023.1"
FT                   /translation="MHVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHS
FT                   KPTQANPQGGISNQEAPIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQVLDK"
FT   variation       345
FT                   /gene="rplX"
FT                   /replace="g"
FT                   /product="ribosomal protein L24"
FT                   /note="found in strain S032"
XX
SQ   Sequence 375 BP; 136 A; 65 C; 85 G; 89 T; 0 other;
     ttgaaataaa tgccttactc aaggaggtgc gatcaggatg catgtaaaaa aaggcgataa        60
     agttatggtt atctctggta aagataaagg caaacaagga acaatccttg ctgctttccc       120
     taaaaaggac cgcgttttag ttgaaggtgt taacatggta aagaaacact ctaaaccaac       180
     tcaagctaac cctcaaggcg gtatttctaa tcaagaggcg ccaattcatg tatcaaacgt       240
     tatgccgctc gatcctaaaa caggtgaagt gactcgcgta ggatacaaag tggaagatgg       300
     caaaaaagtt cgtgtagcaa aaaaatctgg gcaagttcta gataaatagt attaaaagga       360
     agggaggtct atctc                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page