(data stored in SCRATCH zone)

EMBL: M84964

ID   M84964; SV 1; linear; genomic DNA; STD; PRO; 5085 BP.
XX
AC   M84964;
XX
DT   27-JAN-1992 (Rel. 30, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 6)
XX
DE   B.subtilis ORF39, grpE, dnaK, and dnaJ genes, complete cds's.
XX
KW   ATPase; chaperonin protein; heat shock protein.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-5085
RX   PUBMED; 1339421.
RA   Wetzstein M., Voelker U., Dedio J., Loebau S., Zuber U., Schiesswohl M.,
RA   Herget C., Hecker M., Schumann W.;
RT   "Cloning, sequencing, and molecular analysis of the dnaK locus from
RT   Bacillus subtilis";
RL   J. Bacteriol. 174(10):3300-3310(1992).
XX
DR   MD5; 13d658b427a81f61a3c6e3c4b1f216b8.
DR   GOA; P54304.
DR   InterPro; IPR004559; HemW-like.
DR   InterPro; IPR006638; Elp3/MiaB/NifB.
DR   InterPro; IPR007197; rSAM.
DR   InterPro; IPR010723; HemN_C.
DR   InterPro; IPR023404; rSAM_horseshoe.
DR   InterPro; IPR034505; Coproporphyrinogen-III_oxidase.
DR   UniProtKB/Swiss-Prot; P54304; HEMW_BACSU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5085
FT                   /organism="Bacillus subtilis"
FT                   /strain="MB11"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        242..1273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /note="ORF39"
FT                   /db_xref="GOA:P25499"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25499"
FT                   /protein_id="AAA22526.1"
FT                   /translation="MLTNRQLLILQVIINDFIKSAQPVGSRTLSKKDEITFSSATIRNE
FT                   MADLEELGFIEKTHSSSGRVPSEKGYRYYVDHLLSPVKLTKSDLDQIHSIFKEKIFELE
FT                   KTVQKSAQILSDLTNYTSIVLGPKLSENYLKQIQIIPIQPDMAVAILVTNTGHVENKTI
FT                   NFPTKMDLSDIEKLVNILNDRLSGVPMDELNERIFKEVVMYLRQHIKNYDNILDALRST
FT                   FHSTNHVEKLFFGGKINMLNQPEFHDITRVRSLLSLIEKEQDVLKLVQSPHTGISIKIG
FT                   KENDYEEMENCSLITASYSVDQKQIGSIAIIGPTRMNYSRVVSLLQHVTSDLSKALTSL
FT                   YDE"
FT   CDS_pept        1345..1908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /product="heat shock protein"
FT                   /db_xref="GOA:P15874"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="PDB:2G61"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15874"
FT                   /protein_id="AAA22527.1"
FT                   /translation="MSEEKQTVEQNETEEQEIIEEQAAADEQQEETNESELLQNQINEL
FT                   QGLLEEKENKLLRVQADFENYKRRSRLEMEASQKYRSQNIVTDLLPALDSFERALQVEA
FT                   DNEQTKSLLQGMEMVHRQLVEALKKEGVEAIEAVGQEFDPNLHQAVMQAEDENYGSNIV
FT                   VEEMQKGYKLKDRVIRPSMVKVNQ"
FT   CDS_pept        1932..3767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /product="heat shock protein"
FT                   /db_xref="GOA:P17820"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="PDB:2FZO"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17820"
FT                   /protein_id="AAA22528.1"
FT                   /translation="MSKVIGIDLGTTNSCVAVLEGGEPKVIANAEGNRTTPSVVAFKNG
FT                   ERQVGEVAKRQSITNPNTIMSIKRHMGTDYKVEIEGKDYTPQEVSAIILQHLKSYAESY
FT                   LGETVSKAVITVPAYFNDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKTDEDQT
FT                   ILVYDLGGGTFDVSILELGDGVFEVRSTAGDNRLGGDDFDQVIIDHLVSEFKKENGIDL
FT                   SKDKMALQRLKDAAEKAKKDLSGVSSTQISLPFITAGEAGPLHLELTLTRAKFEELSSH
FT                   LVERTMGPVRQALQDAGLSASEIDKVILVGGSTRIPAVQEAIKKETGKEAHKGVNPDEV
FT                   VALGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTA
FT                   ADNQTAVDIHVLQGERPMSADNKTLGRFQLTDIPPAPRGVPQIEVSFDIDKNGIVNVRA
FT                   KDLGTGKEQNITIKSSSGLSDEEIERMVKEAEENADADAKKKEEIEVRNEADQLVFQTE
FT                   KTLKDLEGKVDEEQVKKANDAKDALKAAIEKNEFEEIKAKKDELQTIVQELSMKLYEEA
FT                   AKAQQAQGGANAEGKADDNVVDAEYEEVNDDQNKK"
FT   CDS_pept        3967..5085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /product="heat shock protein"
FT                   /db_xref="GOA:P17631"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17631"
FT                   /protein_id="AAA22529.1"
FT                   /translation="MSKRDYYEVLGVSKSASKDEIKKAYRKLSKKYHPDINKEAGSDEK
FT                   FKEVKEAYETLSDDQKRAHYDQFGHTDPNQGFGGGGFGGGDFGGFGFDDIFSSIFGGGT
FT                   RRRDPKLRARGADLQYTMTLSFEDAAFGKETTIEIPREETCETCKGSGAKPGTNPETCS
FT                   HCGGSGQLNVEQNTPFGKVVNRRVCHHCEGTGKIIKNKCADCGGKGKIKKRKKINVTIP
FT                   AGVDDGQQLRLSGQGEPGINGGLPDLFVVFHVRAHEFFERDGDDIYCEMPLTFAQAALG
FT                   DEVEVPTLHGKVKIPAGTQTGTKFRLRGKGVQNVRGYGQGDQHIVVRVVTPTNLTDKQK
FT                   DIIREFAEVSGNLPDEQEMSFFDKVKRAFKGD"
XX
SQ   Sequence 5085 BP; 1668 A; 1043 C; 1177 G; 1197 T; 0 other;
     cagaaaaata cggccgttcc ctggatggac ttttcccaag cgtgttaaaa gacctcgctg        60
     aaaaagggct gattcacaat tcggagtctg ccgtttattt gactcatcaa ggaaattatt       120
     aggcaatgaa gtttttggcg ctttttttgg gtgagttata attgacattt ttcttgtggt       180
     ttgatacttt tgttatagaa ttagcactcg cttattgaga gtgctaacag aggtgatgat       240
     gatgttaaca aatcgtcagc tgctgatcct tcaggttata atcaacgatt ttattaaatc       300
     ggcacagccg gtgggatcaa gaactctttc gaaaaaagat gaaatcacat ttagctctgc       360
     aacaataaga aacgagatgg ctgacttgga ggaattgggc tttattgaaa aaacccattc       420
     atcctcagga cgtgttccgt cagaaaaagg gtatcggtac tatgttgacc atttgctgtc       480
     acccgtcaaa ttgacgaaaa gcgacctgga ccaaatccac tcgatcttca aagagaaaat       540
     tttcgagctg gagaagacag ttcaaaaatc agcgcaaatt ttgtccgatc tgacgaatta       600
     cacatccatc gtactcgggc cgaagttgag tgagaattac cttaaacaga ttcaaatcat       660
     tccgattcag cctgatatgg cggtagcgat tctcgttacc aatacggggc atgtggaaaa       720
     caaaacgatt aactttccga ccaaaatgga tctgtctgat attgaaaaac tggtaaatat       780
     actgaacgac cgtttaagcg gcgttccaat ggatgaactg aatgagcgca tatttaaaga       840
     agttgtcatg tacctaagac agcacattaa aaactatgac aatatactcg acgcgcttcg       900
     ttcaaccttt cattccacaa atcacgttga aaagttgttt tttggcggga aaatcaatat       960
     gctgaaccag cctgagttcc atgatatcac ccgagttcgg tcgctgcttt cattaattga      1020
     gaaagaacag gatgttttaa agctggttca atccccgcac acgggaattt cgattaaaat      1080
     cggaaaagaa aacgactatg aagagatgga aaattgcagt ctgattacgg cttcttattc      1140
     cgtagaccag aagcagatcg gctcaattgc gattatcggc ccgacccgca tgaattattc      1200
     cagggttgtc agcctgcttc agcatgtgac ttcggacttg tcaaaagcat taacaagtct      1260
     gtatgatgaa taagggaatt ttggcaaatt ttatcgaagg gcagcacctg tccttctcct      1320
     tacactttga gggaggtgaa cacaatgtca gaagaaaaac aaaccgttga acaaaacgaa      1380
     acagaagagc aagaaatcat tgaagaacaa gctgccgctg atgaacagca ggaagaaaca      1440
     aatgaaagcg aacttcttca aaaccaaatt aacgaattgc aaggtttgct tgaggaaaaa      1500
     gaaaacaaac ttttgcgtgt tcaagcagac tttgaaaact ataaacgacg cagccgttta      1560
     gagatggaag cgtcccaaaa ataccgttct caaaatatcg tgactgattt gctgccggct      1620
     cttgacagtt ttgaacgagc gcttcaggtt gaagccgaca atgaacagac gaaaagtttg      1680
     ctccagggaa tggaaatggt ccaccgtcag ctcgtagaag ccttgaaaaa agaaggcgtc      1740
     gaagccatcg aagctgtagg gcaggaattt gatcctaatc tgcaccaagc tgttatgcag      1800
     gctgaagacg aaaactacgg ctccaacatt gttgttgagg aaatgcaaaa aggctataag      1860
     ctgaaggatc gcgtcattcg cccttccatg gtcaaagtga atcaataatt acatagcagg      1920
     aggttattca agtgagtaaa gttatcggaa tcgacttagg aacaacaaac tcatgtgtgg      1980
     cagtgcttga aggcggcgag cctaaagtta ttgctaacgc tgaaggaaac cgcacaacgc      2040
     catcagttgt tgcatttaaa aacggcgaac gtcaagtagg ggaagtggct aaacgccaat      2100
     ctattacaaa ccctaacaca attatgtcta tcaaacgtca tatgggtact gattataaag      2160
     ttgaaattga aggaaaggat tacactccac aagaagtgtc tgctatcatc cttcaacacc      2220
     ttaaatcata cgctgaaagc tatcttggcg aaacagtatc aaaagcagtt atcacagttc      2280
     ctgcatactt taacgatgct gagcgtcaag caacaaaaga cgctggtaaa attgcaggtc      2340
     ttgaagtaga acgtatcatc aacgagccga ctgcagcagc gcttgcatac ggacttgata      2400
     aaacagatga agatcaaacg atcctagtat acgaccttgg cggcggtaca ttcgacgttt      2460
     ccatccttga gcttggcgac ggtgtattcg aagttcgttc aactgccggc gacaaccgtc      2520
     tgggtgggga cgattttgac caagttatca tcgatcatct ggtgtctgaa ttcaaaaaag      2580
     aaaacggcat tgatttgtca aaagacaaaa tggcgcttca gcgtttgaaa gacgcagctg      2640
     aaaaagcgaa aaaagatctt tccggcgtat cttctacgca aatttcttta ccgtttatca      2700
     cagctggaga agcaggaccg cttcaccttg aacttacatt aactcgcgct aaattcgaag      2760
     agctttcttc tcatttagta gagcgcacaa tgggtcctgt ccgtcaagcg cttcaagatg      2820
     caggactttc tgcaagcgaa atcgacaaag tcatccttgt cggcggatca actcgtatcc      2880
     ctgccgtaca agaagcaatc aaaaaagaaa ctggaaaaga agcgcataaa ggcgtaaacc      2940
     cggatgaagt tgtagcgctt ggtgctgcga ttcagggcgg cgttatcaca ggtgacgtaa      3000
     aagatgttgt tcttcttgac gttacaccgc tttctctcgg tatcgaaaca atgggcggtg      3060
     tgtttacaaa actgatcgac cgcaacacga cgatcccaac aagcaaatct caagtgttct      3120
     caactgctgc tgataaccaa acagctgttg atatccatgt tcttcaaggt gagcgcccaa      3180
     tgtctgccga caacaaaaca ctcggccgct tccagcttac tgatatcccg ccagcaccgc      3240
     gcggcgtgcc tcaaatcgaa gtttctttcg atattgacaa aaacggtatc gtaaacgtaa      3300
     gagcaaaaga cttaggcaca ggaaaagaac aaaacattac aatcaaatct tcttcaggtc      3360
     tctcagatga agagatcgaa cgcatggtaa aagaagcgga agaaaatgct gacgctgatg      3420
     cgaagaaaaa agaagaaatc gaagtccgca acgaagcaga tcagcttgtt ttccaaactg      3480
     agaaaacatt aaaagatctt gaaggcaaag tggacgaaga acaagtgaaa aaagccaacg      3540
     atgccaaaga cgctttaaaa gcagcgattg agaaaaacga atttgaagag atcaaagcga      3600
     aaaaagatga gcttcaaaca atcgttcaag agctttctat gaagctttat gaagaagctg      3660
     ctaaagcaca gcaagctcaa ggcggagcaa acgctgaagg caaagcggat gacaacgttg      3720
     tcgacgctga atacgaagaa gtaaacgacg accaaaacaa aaaataagtt ctttttagtg      3780
     tcagccccgc ttccggagct gaccgaaaag aacacatttc ataatctgat tcaatgatta      3840
     gaaagtcaaa gtcaggcatc tcttggcttt gacttttttt cttgcccggg ataaaaggaa      3900
     ttgaaaaatc ataattcaaa atgatacaat ctaatttatg tgagaaattc gggagagtga      3960
     agcgagatga gtaagcgtga ttactatgaa gtgctgggag taagtaagag cgcttcaaag      4020
     gatgaaatta aaaaagctta tcggaagctg tcaaaaaaat atcatcctga tattaacaaa      4080
     gaagccggat cagatgaaaa atttaaagag gtaaaagaag catacgaaac gctgtcagat      4140
     gaccaaaaac gtgcgcatta cgatcaattt ggtcacactg accctaacca aggcttcggc      4200
     ggcggaggtt ttggcggcgg cgatttcggc ggttttggtt tcgatgatat tttctcaagt      4260
     atattcggcg gaggcacaag acgaagagat ccaaaactcc gcgccagggg tgctgattta      4320
     cagtatacga tgaccctgtc gtttgaggat gcggctttcg gtaaagaaac aaccatcgaa      4380
     attccccgcg aggaaacgtg cgaaacatgt aaaggctcag gtgcgaaacc tggaacaaat      4440
     ccagaaacat gctcccactg cggaggctcc ggccagttaa acgtggagca aaatacaccg      4500
     tttggaaaag tcgttaacag acgggtctgc caccactgtg aaggtacagg caaaatcatt      4560
     aaaaacaaat gtgcggactg cggcggcaaa ggaaaaatca aaaaacgcaa gaaaatcaat      4620
     gtgacaattc cagccggtgt agatgacggg cagcagcttc gtctctcggg acagggtgaa      4680
     ccaggaataa acggcggcct gccggattta tttgtcgtgt tccatgtacg cgcacacgag      4740
     ttcttcgagc gtgacggcga tgatatttac tgtgaaatgc cgttaacgtt tgctcaggct      4800
     gctcttggag atgaggtaga agtgccgacg ctgcatggaa aagtgaaaat tccggccggt      4860
     acacaaacag gaacgaaatt cagattaaga ggcaaaggcg ttcaaaatgt cagaggctat      4920
     ggacagggtg accagcatat cgtcgtccgc gtcgttacgc cgacaaatct gactgataaa      4980
     caaaaagaca ttatccgcga atttgccgaa gtcagcggaa acctgcctga cgaacaggaa      5040
     atgagtttct ttgacaaggt aaaacgcgcg tttaaaggcg attaa                      5085
//

If you have problems or comments...

PBIL Back to PBIL home page