(data stored in SCRATCH zone)

EMBL: M85047

ID   M85047; SV 1; linear; genomic DNA; STD; PRO; 1800 BP.
XX
AC   M85047;
XX
DT   27-JAN-1992 (Rel. 30, Created)
DT   29-MAY-2008 (Rel. 95, Last updated, Version 8)
XX
DE   Bacillus subtilis RNA polymerase sigma factor gene and DD-carboxypeptidase
DE   gene, complete cds.
XX
KW   DD-Carboxypeptidase; sigma factor; sporulation operon.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-1800
RX   PUBMED; 1629150.
RA   Wu J.J., Schuch R., Piggot P.J.;
RT   "Characterization of a Bacillus subtilis sporulation operon that includes
RT   genes for an RNA polymerase sigma factor and for a putative
RT   DD-carboxypeptidase";
RL   J. Bacteriol. 174(15):4885-4892(1992).
XX
DR   MD5; c32520e4c6597763ef4e5573463d2c67.
DR   GOA; P46354.
DR   InterPro; IPR000845; Nucleoside_phosphorylase_d.
DR   InterPro; IPR011268; Purine_phosphorylase.
DR   InterPro; IPR011270; Pur_Nuc_Pase_Ino/Guo-sp.
DR   InterPro; IPR018099; Purine_phosphorylase-2_CS.
DR   InterPro; IPR035994; Nucleoside_phosphorylase_sf.
DR   UniProtKB/Swiss-Prot; P46354; PUNA_BACSU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1800
FT                   /organism="Bacillus subtilis"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="spore"
FT                   /db_xref="taxon:1423"
FT   misc_RNA        378..405
FT                   /product="RNA polymerase sigma factor"
FT                   /function="transcription terminator"
FT                   /note="putative"
FT   regulatory      483..492
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        502..1671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="DD-carboxypeptidase"
FT                   /note="putative"
FT                   /db_xref="GOA:P38422"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38422"
FT                   /protein_id="AAA22704.1"
FT                   /translation="MKRLLSTLLIGIMLLTFAPSAFAKQDGKRTSELAHEAKSAVLIER
FT                   DTGKVLYNKNSNERLAPASMTKIMTMLLIMEALDKGKIKMSDKVRTSEHAASMGGSQIF
FT                   LEPGEEMTVKEMLKGIAIASGNDASVAMAEFISGSEEEFVKKMNKKAKELGLKNTSFKN
FT                   PTGLTEEGHYSSAYDMAIMAKELLKYESITKFTGTYEDYLRENTDKKFWLVNTNRLIKF
FT                   YPGVDGVKTGYTGEAKYCLTASAKKGNMRAIAVVFGASTPKERNAQVTKMLDFAFSQYE
FT                   THPLYKRNQTVAKVKVKKGKQKFIELTTSEPISILTKKGEDMNDVKKEIKMKDNISAPI
FT                   QKGQELGTLVLKKDGEVLAESPVAAKEDMKKAGFISFLKRTMGDWTKFK"
FT   sig_peptide     502..570
FT   mat_peptide     571..1668
FT                   /product="DD-carboxypeptidase"
FT                   /note="putative"
XX
SQ   Sequence 1800 BP; 614 A; 338 C; 418 G; 430 T; 0 other;
     cggtacccgg ggatctgtcc agcctggctg aaaagattgc gaaagacctt aatatcccaa        60
     ttcaaaaagg cgtgtacact gatgtgacag gaccttctta cgaaacaccg gcagaagtcc       120
     gtttcttaag aacgatgggc tctgatgcag tcggcatgtc tactgttccg gaagtcattg       180
     tagcgaatca tgcgggaatg cgggttcttg ccatttcctg catctctaac gcggcagccg       240
     gaattctgga tcagccttta agtcacgatg aagttatgga agtgaccgaa aaagtaaaag       300
     ctggattctt aaagcttgtt aaagcgatcg tcgctcagta cgaataaata tgaatcaatg       360
     caggaccaaa agacagctgt gtctgatatc acacagctgt ctttttttat gcccaaaatt       420
     cgaaacattt tccatcagtg gcgtataaaa ccatcacgct tggaaaaaat aaaaaggatt       480
     atgaaatgga gggcttttga gatgaaacgt cttttatcca ctttgttgat tggtataatg       540
     ctgcttacat ttgcaccgtc tgcatttgca aaacaagacg gaaaacgtac atcggagctt       600
     gctcatgaag cgaagtctgc ggtgctgata gaacgtgaca cgggaaaagt gctttacaac       660
     aagaacagca atgagagact ggcgcctgca agcatgacga aaattatgac gatgcttttg       720
     attatggaag ctttagataa aggcaaaatc aaaatgagtg ataaggtccg tacaagcgag       780
     catgcggcgt caatgggcgg ctcacagata ttccttgagc ccggcgaaga aatgactgtc       840
     aaagaaatgc tgaaaggcat cgcaatcgct tcgggaaatg acgcttccgt cgccatggct       900
     gaatttattt ccggctctga agaagaattt gtgaagaaaa tgaataaaaa agcaaaagag       960
     ctgggattga aaaatacatc ctttaaaaac ccaacaggac tgaccgagga aggacactac      1020
     agctctgctt atgacatggc aatcatggct aaggaattat tgaaatacga atcaattacg      1080
     aagtttaccg gcacgtatga agattatctg cgtgaaaata cagataaaaa gttttggctt      1140
     gtaaatacaa atcgccttat caaattttat cctggtgtag acggcgtaaa aacaggctat      1200
     acaggcgaag cgaaatattg tctgactgct tcggctaaaa aaggaaacat gcgggccata      1260
     gcggttgtat tcggagcgag cacgcctaaa gaaagaaacg cgcaagtgac aaaaatgctt      1320
     gacttcgcct ttagccaata tgaaacgcat cctttatata aacgaaatca aacagtagca      1380
     aaagtaaagg tcaaaaaagg gaaacaaaaa tttatcgaac tcactacatc tgagccgatt      1440
     tcaatattga cgaaaaaagg cgaggatatg aacgatgtga aaaaagaaat caagatgaag      1500
     gacaatatta gtgctccgat tcaaaaaggc caagagcttg gcactcttgt tctgaaaaag      1560
     gatggagaag tactcgctga aagtcctgtt gctgcaaaag aagatatgaa gaaagccggg      1620
     tttatctcat tcttaaagcg gacgatggga gactggacaa aatttaagta attatgccga      1680
     atgaccacta gttttgtcac ggtgaaggaa ttcattccgt cgaaatcgaa acactcatta      1740
     tccgatcata tcaaggagga atgagcatga gccttggaat tgacatgaat gtcaaagaat      1800
//

If you have problems or comments...

PBIL Back to PBIL home page