(data stored in SCRATCH zone)

EMBL: M86757

ID   M86757; SV 1; linear; mRNA; STD; HUM; 415 BP.
XX
AC   M86757;
XX
DT   24-FEB-1992 (Rel. 31, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Human psoriasin mRNA, complete cds.
XX
KW   calpactin; psoriasin.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-415
RX   DOI; 10.1111/1523-1747.ep12484041.
RX   PUBMED; 1940442.
RA   Madsen P.S., Rasmussen H.H., Leffers H., Honore B., Dejgaard K., Olsen E.,
RA   Kiil J., Walbum E., Andersen A., Basse B., Lauridsen J.B., Ratz G.,
RA   Celis A., Vandekerckhove J.S., Celis J.E.;
RT   "Molecular cloning, occurrence, and expression of a novel partially
RT   secreted protein "psoriasin" that is highly up-regulated in psoriatic
RT   skin";
RL   J. Invest. Dermatol. 97(4):701-712(1991).
XX
DR   MD5; 8cb27dd4fbfd5a1ffcd049f7cb4a1eb3.
DR   Ensembl-Gn; ENSG00000143556; homo_sapiens.
DR   Ensembl-Tr; ENST00000368722; homo_sapiens.
DR   Ensembl-Tr; ENST00000368723; homo_sapiens.
DR   EuropePMC; PMC311024; 11230159.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..415
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_type="keratinocytes"
FT                   /tissue_lib="lambda gt11"
FT                   /tissue_type="epidermis"
FT                   /db_xref="taxon:9606"
FT   gene            50..355
FT                   /gene="psoriasin"
FT   CDS_pept        50..355
FT                   /codon_start=1
FT                   /gene="psoriasin"
FT                   /product="psoriasin"
FT                   /db_xref="GOA:P31151"
FT                   /db_xref="H-InvDB:HIT000196645.14"
FT                   /db_xref="HGNC:HGNC:10497"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028477"
FT                   /db_xref="InterPro:IPR034325"
FT                   /db_xref="PDB:1PSR"
FT                   /db_xref="PDB:2PSR"
FT                   /db_xref="PDB:2WND"
FT                   /db_xref="PDB:2WOR"
FT                   /db_xref="PDB:2WOS"
FT                   /db_xref="PDB:3PSR"
FT                   /db_xref="PDB:4AQJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31151"
FT                   /protein_id="AAA60210.1"
FT                   /translation="MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLS
FT                   ACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ"
XX
SQ   Sequence 415 BP; 126 A; 108 C; 95 G; 86 T; 0 other;
     aattcttcta ctcgtgacgc ttcccagctc tggctttttg aaagcaaaga tgagcaacac        60
     tcaagctgag aggtccataa taggcatgat cgacatgttt cacaaataca ccagacgtga       120
     tgacaagatt gacaagccaa gcctgctgac gatgatgaag gagaacttcc ccaacttcct       180
     tagtgcctgt gacaaaaagg gcacaaatta cctcgccgac gtctttgaga aaaaggacaa       240
     gaatgaggat aagaagattg atttttctga gtttctgtcc ttgctgggag acatagccac       300
     agactaccac aagcagagcc atggagcagc gccctgttcc gggggcagcc agtgacccag       360
     ccccaccaat gggcctccag agacccagga acaataaaat gtcttctccc accag            415
//

If you have problems or comments...

PBIL Back to PBIL home page