(data stored in SCRATCH zone)

EMBL: M97391

ID   M97391; SV 1; linear; genomic DNA; STD; PRO; 3698 BP.
XX
AC   M97391; M96937;
XX
DT   06-MAR-1993 (Rel. 35, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Bacillus subtilis branched chain alpha-keto acid dehydrogenase E1-alpha,
DE   branched chain alpha-keto acid dehydrogenase E1-beta, and branched chain
DE   alpha-keto acid dehydrogenase E2, complete cds.
XX
KW   branched chain alpha-keto acid dehydrogenase.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-3698
RX   DOI; 10.1111/j.1432-1033.1993.tb17858.x.
RX   PUBMED; 8504804.
RA   Wang G.F., Kuriki T., Roy K.L., Kaneda T.;
RT   "The primary structure of branched-chain alpha-oxo acid dehydrogenase from
RT   Bacillus subtilis and its similarity to other alpha-oxo acid
RT   dehydrogenases";
RL   Eur. J. Biochem. 213(3):1091-1099(1993).
XX
DR   MD5; 6047d0ef143a6ca02064c6e6e1b4dee0.
DR   GOA; P54533.
DR   InterPro; IPR001100; Pyr_nuc-diS_OxRdtase.
DR   InterPro; IPR004099; Pyr_nucl-diS_OxRdtase_dimer.
DR   InterPro; IPR006258; Lipoamide_DH.
DR   InterPro; IPR012999; Pyr_OxRdtase_I_AS.
DR   InterPro; IPR016156; FAD/NAD-linked_Rdtase_dimer_sf.
DR   InterPro; IPR023753; FAD/NAD-binding_dom.
DR   InterPro; IPR036188; FAD/NAD-bd_sf.
DR   UniProtKB/Swiss-Prot; P54533; DLDH2_BACSU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3698
FT                   /organism="Bacillus subtilis"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   regulatory      204..218
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        216..1208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="branched chain alpha-keto acid dehydrogenase
FT                   E1-alpha"
FT                   /db_xref="GOA:P37940"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37940"
FT                   /protein_id="AAA22278.1"
FT                   /translation="MSTNRHQALGLTDQEAVDMYRTMLLARKIDERMWLLNRSGKIPFV
FT                   ISCQGQEAAQVGAAFALDREMDYVLPYYRDMGVVLAFGMTAKDLMMSGFAKAADPNSGG
FT                   RQMPGHFGQKKNRIVTGSSPVTTQVPHAVGIALAGRMEKKDIAAFVTFGEGSSNQGDFH
FT                   EGANFAAVHKLPVIFMCENNKYAISVPYDKQVACENISDRAIGYGMPGVTVNGNDPLEV
FT                   YQAVKEARERARRGEGPTLIETISYRLTPHSSDDDDSSYRGREEVEEAKKSDPLLTYQA
FT                   YLKETGLLSDEIEQTMLDEIMAIVNEATDEAENAPYAAPESALDYVYAK"
FT   regulatory      1209..1224
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        1222..2205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="branched chain alpha-keto acid dehydrogenase
FT                   E1-beta"
FT                   /db_xref="GOA:P37941"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37941"
FT                   /protein_id="AAA22279.1"
FT                   /translation="MSVMSYIDAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLY
FT                   EQFGEERVMDTPLAESAIAGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYR
FT                   SNNDWSCPIVVRAPYGGGVHGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVR
FT                   DEDPVLFFEHKRAYRLIKGEVPADDYVLPIGKADVKREGDDITVITYGLCVHFALQAAE
FT                   RLEKDGISAHVVDLRTVYPLDKEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHC
FT                   LFDLDAPIKRLAGPDIPAMPYAPTMEKYFMVNPDKVEAAMRELAEF"
FT   regulatory      2215..2230
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        2228..3502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="branched chain alpha-keto acid dehydrogenase E2"
FT                   /db_xref="GOA:P37942"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37942"
FT                   /protein_id="AAA22280.1"
FT                   /translation="MAIEQMTMPQLGESVTEGTISKWLVAPGDKVNKYDPIAEVMTDKV
FT                   NAEVPSSFTGTITELVGEEGQTLQVGEMICKIETEGANPAEQKQEQPAASEAAENPVAK
FT                   SAGAADQPNKKRYSPAVLRLAGEHGIDLDQVTGTGAGGRITRKDIQRLIETGGVQEQNP
FT                   EELKTAAPAPKSASKPEPKEETSYPASAAGDKEIPVTGVRKAIASNMKRSKTEIPHAWT
FT                   MMEVDVTNMVAYRNSIKDSFKKTEGFNLTFFAFFVKAVAQALKEFPQMNSMWAGDKIIQ
FT                   KKDINISIAVATEDSLFVPVIKNADEKTIKGIAKDITGLAKKVRDGKLTADDMQGGTFT
FT                   VNNTGSFGSVQSMGIINYPQAAILQVESIVKRPVVMDNGMIAVRDMVNLCLSLDHRVLD
FT                   GLVCGRFLGRVKQILESIDEKTSVY"
FT   regulatory      3509..3553
FT                   /regulatory_class="terminator"
XX
SQ   Sequence 3698 BP; 1116 A; 779 C; 950 G; 853 T; 0 other;
     agatacagat gatattctcg gcgttcatat gattggcccg catgtgcacc gacatgattt        60
     ctgaagcggg tcttgccaaa gtgctggacg caacaccgtg ggaggtcggg caaacgattc       120
     acccgcatcc aacgctttct gaagcaattg gagaagctgc gcttgccgca gatggcaaag       180
     ccattcattt ttaaaagcat aaaggagggg cttgaatgag tacaaaccga catcaagcac       240
     tagggctgac tgatcaggaa gccgttgata tgtatagaac catgctgtta gcaagaaaaa       300
     tcgatgaaag aatgtggctg ttaaaccgtt ctggcaaaat tccatttgta atctcttgtc       360
     aaggacagga agcagcacag gtaggagcgg ctttcgcact tgaccgtgaa atggattatg       420
     tattgccgta ctacagagac atgggtgtcg tgctcgcgtt tggcatgaca gcaaaggact       480
     taatgatgtc cgggtttgca aaagcagcag atccgaactc aggaggccgc cagatgccgg       540
     gacatttcgg acaaaagaaa aaccgcattg tgacgggatc atctccggtt acaacgcaag       600
     tgccgcacgc agtcggtatt gcgcttgcgg gacgtatgga gaaaaaggat atcgcagcct       660
     ttgttacatt cggggaaggg tcttcaaacc aaggcgattt ccatgaaggg gcaaactttg       720
     ccgctgtcca taagctgccg gttattttca tgtgtgaaaa caacaaatac gcaatctcag       780
     tgccttacga taagcaagtc gcatgtgaga acatttccga ccgtgccata ggctatggga       840
     tgcctggcgt aactgtgaat ggaaatgatc cgctggaagt ttatcaagcg gttaaagaag       900
     cacgcgaaag ggcacgcaga ggagaaggcc cgacattaat tgaaacgatt tcttaccgcc       960
     ttacaccaca ttccagtgat gacgatgaca gcagctacag aggccgtgaa gaagtagagg      1020
     aagcgaaaaa aagtgatccc ctgcttactt atcaagctta cttaaaggaa acaggcctgc      1080
     tgtccgatga gatagaacaa accatgctgg atgaaattat ggcaatcgta aatgaagcga      1140
     cggatgaagc ggagaacgcc ccatatgcag ctcctgagtc agcgcttgat tatgtttatg      1200
     cgaagtaggg aggaagaaca aatgtcagta atgtcatata ttgatgcaat caatttggcg      1260
     atgaaagaag aaatggaacg agattctcgc gttttcgtcc ttggggaaga tgtaggaaga      1320
     aaaggcggtg tgtttaaagc gacagcggga ctctatgaac aatttgggga agagcgcgtt      1380
     atggatacgc cgcttgctga atctgcaatc gcaggagtcg gtatcggagc ggcaatgtac      1440
     ggaatgagac cgattgctga aatgcagttt gctgatttca ttatgccggc agtcaaccaa      1500
     attatttctg aagcggctaa aatccgctac cgcagcaaca atgactggag ctgtccgatt      1560
     gtcgtcagag cgccatacgg cggaggcgtg cacggagccc tgtatcattc tcaatcagtc      1620
     gaagcaattt tcgccaacca gcccggactg aaaattgtca tgccatcaac accatatgac      1680
     gcgaaagggc tcttaaaagc cgcagttcgt gacgaagacc ccgtgctgtt ttttgagcac      1740
     aagcgggcat accgtctgat aaagggcgag gttccggctg atgattatgt cctgccaatc      1800
     ggcaaggcgg acgtaaaaag ggaaggcgac gacatcacag tgatcacata cggcctgtgt      1860
     gtccacttcg ccttacaagc tgcagaacgt ctcgaaaaag atggcatttc agcgcatgtg      1920
     gtggatttaa gaacagttta cccgcttgat aaagaagcca tcatcgaagc tgcgtccaaa      1980
     actggaaagg ttcttttggt cacagaagat acaaaagaag gcagcatcat gagcgaagta      2040
     gccgcaatta tatccgagca ttgtctgttc gacttagacg cgccgatcaa acggcttgca      2100
     ggtcctgata ttccggctat gccttatgcg ccgacaatgg aaaaatactt tatggtcaac      2160
     cctgataaag tggaagcggc gatgagagaa ttagcggagt tttaaagacg taagggagga      2220
     tacaatcatg gcaattgaac aaatgacgat gccgcagctt ggagaaagcg taacagaggg      2280
     gacgatcagc aaatggcttg tcgcccccgg tgataaagtg aacaaatacg atccgatcgc      2340
     ggaagtcatg acagataagg taaatgcaga ggttccgtct tcttttactg gtacgataac      2400
     agagcttgtg ggagaagaag gccaaaccct gcaagtcgga gaaatgattt gcaaaattga      2460
     aacagaaggc gcgaatccgg ctgaacaaaa acaagaacag ccagcagcat cagaagccgc      2520
     tgagaaccct gttgcaaaaa gtgctggagc agccgatcag cccaataaaa agcgctactc      2580
     gccagctgtt ctccgtttgg ccggagagca cggcattgac ctcgatcaag tgacaggaac      2640
     tggtgccggc gggcgcatca cacgaaaaga tattcagcgc ttaattgaaa caggcggcgt      2700
     gcaagaacag aatcctgagg agctgaaaac agcagctcct gcaccgaagt ctgcatcaaa      2760
     acctgagcca aaagaagaga cgtcatatcc tgcgtctgca gccggtgata aagaaatccc      2820
     tgtcacaggt gtaagaaaag caattgcttc caatatgaag cgaagcaaaa cagaaattcc      2880
     gcatgcttgg acgatgatgg aagtcgacgt cacaaatatg gttgcatatc gcaacagtat      2940
     aaaagattct tttaagaaga cagaaggctt taatttaacg ttcttcgcct tttttgtaaa      3000
     agcggtcgct caggcgttaa aagaattccc gcaaatgaat agcatgtggg cgggggacaa      3060
     aattattcag aaaaaggata tcaatatttc aattgcagtt gccacagagg attctttatt      3120
     tgttccggtg attaaaaacg ctgatgaaaa aacaattaaa ggcattgcga aagacattac      3180
     cggcctagct aaaaaagtaa gagacggaaa actcactgca gatgacatgc agggaggcac      3240
     gtttaccgtc aacaacacag gttcgttcgg gtctgttcag tcgatgggca ttatcaacta      3300
     ccctcaggct gcgattcttc aagtagaatc catcgtcaaa cgcccggttg tcatggacaa      3360
     tggcatgatt gctgtcagag acatggttaa tctgtgcctg tcattagatc acagagtgct      3420
     tgacggtctc gtgtgcggac gattcctcgg acgagtgaaa caaattttag aatcgattga      3480
     cgagaagaca tctgtttact aaataagcaa aaagagcatt ttttgaagtt ttgtttcaaa      3540
     aaatgctctt tttctatgct ttattattca gcgatccgta ttttcatttc gactcgatat      3600
     tcttcttgtt ttttcgggga gtaatgaatc ggtatgatta actcgtatac atcactgaca      3660
     actgttaatt ggcggtccgc gatatatttg ataagctt                              3698
//

If you have problems or comments...

PBIL Back to PBIL home page