(data stored in ACNUC23119 zone)

EMBL: M97901

ID   M97901; SV 1; linear; mRNA; STD; HUM; 396 BP.
XX
AC   M97901;
XX
DT   29-AUG-1992 (Rel. 33, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 6)
XX
DE   Human pink-eyed dilution homologue mRNA, 5' end.
XX
KW   pink-eyed dilution protein.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-396
RX   DOI; 10.1126/science.257.5073.1121.
RX   PUBMED; 1509264.
RA   Brilliant M.H., King R.A., Lyon M.F., Lee S., Gondo Y., Nakatsu Y.,
RA   Gardner J.M.;
RT   "The mouse pink-eyed dilution gene: association with human Prader-Willi and
RT   Angelman syndromes.";
RL   Science, e1252229 257(5073):1121-1124(1992).
XX
DR   MD5; 2e612f0540b9c687f9daa45f8fdc13b1.
DR   Ensembl-Gn; ENSG00000104044; homo_sapiens.
DR   Ensembl-Tr; ENST00000353809; homo_sapiens.
DR   Ensembl-Tr; ENST00000354638; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..396
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_type="melanoma"
FT                   /tissue_type="skin"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..396
FT                   /partial
FT                   /codon_start=1
FT                   /product="pink-eyed dilution protein"
FT                   /note="homologus to aa sequence 283 to 414 of mouse
FT                   pink-eyed dilution gene product; homologue"
FT                   /db_xref="GOA:Q04671"
FT                   /db_xref="H-InvDB:HIT000196997.13"
FT                   /db_xref="HGNC:HGNC:8101"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04671"
FT                   /protein_id="AAA36430.1"
FT                   /translation="MSRTFEVLTRETVSISIRASLQQTQAVPLLMAHQYLRGSVETQVT
FT                   IATAILAGVYALIIFEIVHRTLAAMLGSLAALAALAVIGDRPSLTHVVEWIDFETLALL
FT                   FGMMILVAIFSETGFFDYCAVKAYRLSR"
XX
SQ   Sequence 396 BP; 79 A; 106 C; 113 G; 98 T; 0 other;
     atgagcagga cctttgaggt actgaccaga gagacggtgt ccatcagcat ccgggcctcc        60
     ctgcagcaga cccaggctgt ccctcttttg atggctcatc agtacctccg cggaagtgta       120
     gaaacccagg tgaccatcgc gacggccatc ctcgcgggcg tctacgcgct gatcatattt       180
     gagatcgtgc acagaactct ggcggccatg ctgggttccc ttgcagcact ggcagcactg       240
     gctgtgattg gcgatagacc cagcctgacc catgtggtgg agtggattga ttttgagacg       300
     ctggccctgc tgtttggcat gatgatctta gtagccatat tttcagaaac gggatttttc       360
     gattattgtg ctgtaaaggc ataccggctc tcccgg                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page