(data stored in ACNUC6288 zone)

EMBL: M98035

ID   M98035; SV 1; linear; mRNA; STD; MUS; 1711 BP.
XX
AC   M98035;
XX
DT   22-AUG-1994 (Rel. 40, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus guanine nucleotide exchange factor delta subunit (JGR1) mRNA,
DE   complete cds.
XX
KW   guanine nucleotide exchange factor; translational regulator.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1711
RX   PUBMED; 7982969.
RA   Henderson R.A., Krissansen G.W., Yong R.Y., Leung E., Watson J.D.,
RA   Dholakia J.N.;
RT   "The delta-subunit of murine guanine nucleotide exchange factor eIF-2B.
RT   Characterization of cDNAs predicts isoforms differing at the amino-terminal
RT   end";
RL   J Biol Chem 269(48):30517-30523(1994).
XX
RN   [2]
RP   1-1711
RA   Dholakia J.N.;
RT   ;
RL   Submitted (20-AUG-1994) to the INSDC.
RL   Jaydev N. Dholakia, Biochemistry, University of Louisville, Louisville, KY
RL   40292, USA
XX
DR   MD5; f292159e996b514857fb497fb7a04e65.
DR   Ensembl-Gn; ENSMUSG00000029145; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029415; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029381; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029331; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029392; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029113; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029845; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028523; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029081; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029230; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029188; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029315; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029217; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029879; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028248; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028604; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000077693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114603; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166769; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070824; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0070903; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0070802; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070828; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070474; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071304; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071008; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0070414; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0070551; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0070463; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0070625; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070486; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071505; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070480; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069628; mus_musculus_wsbeij.
DR   EuropePMC; PMC18509; 10811900.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1711
FT                   /organism="Mus musculus"
FT                   /strain="CBA/J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /cell_type="B cell"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        44..1678
FT                   /codon_start=1
FT                   /gene="JGR1"
FT                   /product="guanine nucleotide exchange factor, eIF-2B, delta
FT                   subunit"
FT                   /note="homology to yeast translational regulators GCD2 and
FT                   GCN3"
FT                   /db_xref="GOA:Q61749"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="MGI:MGI:95300"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61749"
FT                   /protein_id="AAA68046.1"
FT                   /translation="MPTQQPAAPTSLPKSSRSLSGSLCALFSDAESRSEMKTELSPRPG
FT                   AAGRELTQEEKLQLRKEKKQQKKKRKEEKGADQEIGSAVSAAQRQDPIRELPGPGSQLG
FT                   GTAGEKLPAGRSKAELRAERRAKQEAERALKQARKGEQGGVPPQACPSTAGETTSGVKR
FT                   VPEHTPADDPTLLRRLLRKPDRQQVPTRKDYGSKVSLFSHLPQYSRQSSLTQYMSIPSS
FT                   VIHPAMVRLGLQYSQGLISGSNARCIALLHALQQVIQDYTTPPSEELSRDLVNKLKPYI
FT                   SFLTQCRPMSASMCNAIKFLTKEVTGMSSSKREEEAKSELKEALDRYVQEKIVLAAQAI
FT                   SRFASTKISDGDVILVYGCSSLVSRILQEARVEGRRFRVVVVDSRPRLEGRHMLHSLVR
FT                   AGVPTSYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGTAQLALVARAHNVPVLVC
FT                   CETYKFCERVQTDAFVSNELDDPDDLQCKRGDQVALANWQSHPSLRLLNLVYDVTPPEL
FT                   VDLVITELGMIPCSSVPVVLRVKSSDQ"
FT   regulatory      1693..1698
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1711
XX
SQ   Sequence 1711 BP; 411 A; 475 C; 480 G; 345 T; 0 other;
     tcccgggatc ccagagcgcc tccgtggcag ccgagctgtg gtcatgccaa cccagcagcc        60
     agctgcgccg acgagtctcc ccaagtcctc ccggagcctc tctggctcac tctgtgccct       120
     gttttctgat gcagaatcga gatccgagat gaagactgaa ctttctcctc ggcccggggc       180
     agcagggcgg gagttgaccc aagaagagaa gcttcagctt cgaaaagaaa agaaacagca       240
     gaagaagaaa cggaaggagg aaaagggggc agaccaagaa attggctctg ctgtgtctgc       300
     agctcaacgg caagacccaa tcagagaact cccaggacct ggtagtcagc tgggaggtac       360
     tgctggggag aaacttccag ctggccggag taaggcagaa cttcgcgccg aaaggagagc       420
     caagcaggag gcagagcggg ccctgaaaca ggcaagaaaa ggggaacaag gaggcgtccc       480
     tcctcaggcc tgccccagca ctgctggaga aaccacctca ggagtgaagc gtgtccccga       540
     gcacacccca gctgatgacc ccacacttct gaggaggctc cttagaaagc cagatcgaca       600
     acaggttcct acacgaaagg attacggatc caaagtcagt ctcttctccc acctgcctca       660
     gtacagcaga caaagctcct tgacccagta catgagcatc ccatcctctg tgatccaccc       720
     agccatggtg agactcggtc tgcagtactc ccagggcctc atcagtggct ccaatgcccg       780
     gtgcatcgca ctgcttcacg ccctgcagca ggtgattcag gattacacaa cacctcccag       840
     tgaggaactc tccagggatc ttgtaaataa actaaaaccc tacatcagct tcctgacgca       900
     gtgccgcccc atgtcggcaa gtatgtgcaa cgccatcaag ttcctaacca aggaagtcac       960
     tggcatgagc agctccaagc gggaagagga ggccaagtca gaacttaaag aagccctcga      1020
     ccggtacgtg caagagaaga tcgtgcttgc agctcaggca atttcacgat ttgcttctac      1080
     aaagatcagt gatggggacg tgatcctggt atatggatgc tcatctttgg tgtcgagaat      1140
     tctccaggag gccagggtcg agggcaggcg gtttcgggtg gtggtggtgg acagccggcc      1200
     ccggctggaa ggaaggcaca tgctccactc tcttgtccgt gctggggtcc ctacctccta      1260
     tctgctgatt cctgcagcct cctatgtgct tccagaggtt tctaaggtgc tattgggagc      1320
     tcatgcactc ctggccaatg gatctgtgat gtctcgggta gggacagcac agttggccct      1380
     ggtggctcga gctcataacg ttccagtact ggtctgctgt gaaacgtaca agttctgtga      1440
     acgtgtgcag actgatgcct ttgtctccaa cgagctagat gatcccgatg atctgcagtg      1500
     taagcgggga gaccaggtgg ccctggctaa ctggcagagc cacccgtccc tccggttgtt      1560
     gaatctggtc tatgacgtga ctccacctga gctcgtggat ctggtgatca cagagttggg      1620
     catgatccct tgcagttctg tgcctgttgt tcttcgagtc aagagcagtg accagtgaag      1680
     ggaacaaggg tcaataaaaa gcttactccc t                                     1711
//

If you have problems or comments...

PBIL Back to PBIL home page