(data stored in ACNUC6288 zone)

EMBL: M98036

ID   M98036; SV 1; linear; mRNA; STD; MUS; 1677 BP.
XX
AC   M98036;
XX
DT   22-AUG-1994 (Rel. 40, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus guanine nucleotide exchange factor delta subunit (JGR1A) mRNA,
DE   complete cds.
XX
KW   guanine nucleotide exchange factor; translational regulator.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1677
RX   PUBMED; 7982969.
RA   Henderson R.A., Krissansen G.W., Yong R.Y., Leung E., Watson J.D.,
RA   Dholakia J.N.;
RT   "The delta-subunit of murine guanine nucleotide exchange factor eIF-2B.
RT   Characterization of cDNAs predicts isoforms differing at the amino-terminal
RT   end";
RL   J Biol Chem 269(48):30517-30523(1994).
XX
RN   [2]
RP   1-1677
RA   Dholakia J.N.;
RT   ;
RL   Submitted (20-AUG-1994) to the INSDC.
RL   Jaydev N. Dholakia, Biochemistry, University of Louisville, Louisville, KY
RL   40292, USA
XX
DR   MD5; e1c5cc85004f000cf5165f8fd0611ce3.
DR   Ensembl-Gn; ENSMUSG00000029145; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029415; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029381; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029331; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029392; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029113; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029845; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028523; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029081; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029230; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029188; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029315; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029217; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029879; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028248; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028604; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000077693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114603; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166769; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070824; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0070903; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0070802; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070828; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070474; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071304; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071008; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0070414; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0070551; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0070463; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0070625; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070486; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071505; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070480; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069628; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1677
FT                   /organism="Mus musculus"
FT                   /strain="CBA/J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /cell_type="B cell"
FT                   /tissue_lib="lambda gt-11"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        70..1644
FT                   /codon_start=1
FT                   /gene="JGR1A"
FT                   /product="guanine nucleotide exchange factor, eIF-2B, delta
FT                   subunit"
FT                   /note="homology to the yeast translational regulators GCD2
FT                   and GCN3"
FT                   /db_xref="GOA:Q61749"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="MGI:MGI:95300"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61749"
FT                   /protein_id="AAA68047.1"
FT                   /translation="MAAVAVAVREESRSEMKTELSPRPGAAGRELTQEEKLQLRKEKKQ
FT                   QKKKRKEEKGADQEIGSAVSAAQRQDPIRELPGPGSQLGGTAGEKLPAGRSKAELRAER
FT                   RAKQEAERALKQARKGEQGGVPPQACPSTAGETTSGVKRVPEHTPADDPTLLRRLLRKP
FT                   DRQQVPTRKDYGSKVSLFSHLPQYSRQSSLTQYMSIPSSVIHPAMVRLGLQYSQGLISG
FT                   SNARCIALLHALQQVIQDYTTPPSEELSRDLVNKLKPYISFLTQCRPMSASMCNAIKFL
FT                   TKEVTGMSSSKREEEAKSELKEALDRYVQEKIVLAAQAISRFASTKISDGDVILVYGCS
FT                   SLVSRILQEARVEGRRFRVVVVDSRPRLEGRHMLHSLVRAGVPTSYLLIPAASYVLPEV
FT                   SKVLLGAHALLANGSVMSRVGTAQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNEL
FT                   DDPDDLQCKRGDQVALANWQSHPSLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVL
FT                   RVKSSDQ"
FT   regulatory      1659..1664
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1677
XX
SQ   Sequence 1677 BP; 409 A; 446 C; 488 G; 334 T; 0 other;
     ggagaggagc agcccaggtg gcgctgtagt gtgagtgacc tcggcgggag gagcctagga        60
     cccacagtca tggctgcggt ggcggtggct gttcgcgaag aatcgagatc cgagatgaag       120
     actgaacttt ctcctcggcc cggggcagca gggcgggagt tgacccaaga agagaagctt       180
     cagcttcgaa aagaaaagaa acagcagaag aagaaacgga aggaggaaaa gggggcagac       240
     caagaaattg gctctgctgt gtctgcagct caacggcaag acccaatcag agaactccca       300
     ggacctggta gtcagctggg aggtactgct ggggagaaac ttccagctgg ccggagtaag       360
     gcagaacttc gcgccgaaag gagagccaag caggaggcag agcgggccct gaaacaggca       420
     agaaaagggg aacaaggagg cgtccctcct caggcctgcc ccagcactgc tggagaaacc       480
     acctcaggag tgaagcgtgt ccccgagcac accccagctg atgaccccac acttctgagg       540
     aggctcctta gaaagccaga tcgacaacag gttcctacac gaaaggatta cggatccaaa       600
     gtcagtctct tctcccacct gcctcagtac agcagacaaa gctccttgac ccagtacatg       660
     agcatcccat cctctgtgat ccacccagcc atggtgagac tcggtctgca gtactcccag       720
     ggcctcatca gtggctccaa tgcccggtgc atcgcactgc ttcacgccct gcagcaggtg       780
     attcaggatt acacaacacc tcccagtgag gaactctcca gggatcttgt aaataaacta       840
     aaaccctaca tcagcttcct gacgcagtgc cgccccatgt cggcaagtat gtgcaacgcc       900
     atcaagttcc taaccaagga agtcactggc atgagcagct ccaagcggga agaggaggcc       960
     aagtcagaac ttaaagaagc cctcgaccgg tacgtgcaag agaagatcgt gcttgcagct      1020
     caggcaattt cacgatttgc ttctacaaag atcagtgatg gggacgtgat cctggtatat      1080
     ggatgctcat ctttggtgtc gagaattctc caggaggcca gggtcgaggg caggcggttt      1140
     cgggtggtgg tggtggacag ccggccccgg ctggaaggaa ggcacatgct ccactctctt      1200
     gtccgtgctg gggtccctac ctcctatctg ctgattcctg cagcctccta tgtgcttcca      1260
     gaggtttcta aggtgctatt gggagctcat gcactcctgg ccaatggatc tgtgatgtct      1320
     cgggtaggga cagcacagtt ggccctggtg gctcgagctc ataacgttcc agtactggtc      1380
     tgctgtgaaa cgtacaagtt ctgtgaacgt gtgcagactg atgcctttgt ctccaacgag      1440
     ctagatgatc ccgatgatct gcagtgtaag cggggagacc aggtggccct ggctaactgg      1500
     cagagccacc cgtccctccg gttgttgaat ctggtctatg acgtgactcc acctgagctc      1560
     gtggatctgg tgatcacaga gttgggcatg atcccttgca gttctgtgcc tgttgttctt      1620
     cgagtcaaga gcagtgacca gtgaagggaa caagggtcaa taaaaagctt actccct         1677
//

If you have problems or comments...

PBIL Back to PBIL home page