(data stored in ACNUC9306 zone)

EMBL: M98498

ID   M98498; SV 1; linear; mRNA; STD; MAM; 2514 BP.
XX
AC   M98498;
XX
DT   19-MAY-1993 (Rel. 35, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Bos taurus ezrin mRNA, complete cds.
XX
KW   ezrin.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RP   1-2514
RX   PUBMED; 19912909.
RA   Bergson C.M., Zhao H., Saijoh K., Duman R.S., Nestler E.J.;
RT   "Ezrin and osteonectin, two proteins associated with cell shape and growth,
RT   are enriched in the locus coeruleus";
RL   Mol. Cell. Neurosci. 4(1):64-73(1993).
XX
DR   MD5; 9e85f9b6f1ea081c5473b45b9efda432.
DR   Ensembl-Gn; ENSBTAG00000010347; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000013663; bos_taurus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2514
FT                   /organism="Bos taurus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9913"
FT   CDS_pept        152..1897
FT                   /codon_start=1
FT                   /product="ezrin"
FT                   /db_xref="GOA:P31976"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31976"
FT                   /protein_id="AAA30510.1"
FT                   /translation="MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYF
FT                   GLQYVDNKGFPTWLKLDKKVSAQEVRKESPLQFKFRAKFYPEDVAEELIQDITQKLFFL
FT                   QVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKELHKAGYLGSERLIPQRVMDQHKL
FT                   TRDQWEDRIQVWHAEHRGMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDA
FT                   LGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
FT                   QLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQM
FT                   MREKEELMLRLQDYEEKTRKAEKELSDQIQRALKLEEERKRAQEEAGRLEADRLAALRA
FT                   KEELERQAADQIKSQEQLATELAEYTAKIALLEEARRRKENEVEEWQLRAKEAQDDLVK
FT                   TREELHLVMTAPPPPPVYEPVNYHVHEGPQEEGTELSAELSSEGILDDRNEEKRITEAE
FT                   KNERVQRQLMTLTSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRID
FT                   EFEAM"
XX
SQ   Sequence 2514 BP; 644 A; 658 C; 738 G; 474 T; 0 other;
     gataagcttg atatcgaatt cggggagcgg caggaggact gctgggcacg ctcatagggc        60
     ttcctccgcc tgcaggtcgg gaaagggcgt ttcagctgct gctggagagc gtgtttccaa       120
     ggaaggcgag aaaacccgtc cagaaccgaa aatgccgaaa ccgatcaacg tccgagtgac       180
     caccatggat gcggagctgg agtttgccat ccagccaaac accacaggaa agcagctttt       240
     tgatcaggtg gttaagacca tcggccttag ggaagtgtgg tactttggcc tccagtatgt       300
     ggataacaaa ggatttccta catggttgaa acttgataaa aaggtgtccg cccaggaggt       360
     caggaaggag agcccgctgc agttcaagtt ccgggccaag ttctaccccg aggacgtggc       420
     cgaggagctc atccaggaca tcacgcagaa gctcttcttc ctgcaagtga aggagggcat       480
     cctcagcgac gagatctact gcccgcccga gaccgccgtg ctcctgggct cctacgccgt       540
     gcaggccaag ttcggcgact acaacaagga gctgcacaag gcggggtacc tcggctccga       600
     gcggctcatc ccccagagag tcatggacca gcacaagctc accagggacc agtgggagga       660
     ccggatccag gtgtggcatg cagaacaccg cgggatgctc aaggacagcg ccatgctgga       720
     atacctgaag atcgcccagg acctggaaat gtacgggatc aactatttcg agataaaaaa       780
     taagaaagga acagaccttt ggctcggcgt tgatgccctt ggactaaata tctatgagaa       840
     agacgataag ttgaccccaa agattggctt cccatggagc gagatcagga acatctcttt       900
     caatgacaag aagtttgtca tcaagcccat cgacaagaag gctcctgact tcgtgttcta       960
     cgccccccgc ctgcggatca acaagcggat cctgcagctc tgcatgggga accatgagct      1020
     gtacatgcgc cgccggaagc ccgacaccat tgaggtgcag cagatgaagg cccaggcccg      1080
     ggaggagaag caccagaagc agctggagag gcagcagttg gaaaccgaga agaagaggag      1140
     agaaaccgtg gagcgagaaa aagagcagat gatgcgtgag aaggaggagc tgatgctcag      1200
     gcttcaggac tacgaggaaa aaaccaggaa ggctgagaaa gagctctccg accagatcca      1260
     gagagcgctg aagctggagg aggagaggaa gcgggcccag gaggaggcgg ggcgcctgga      1320
     ggctgaccgc ctggccgcgc tgcgtgccaa ggaggagctg gagaggcagg cagccgacca      1380
     gatcaagagc caggagcagc tggccacaga gctcgccgag tacaccgcca agatcgccct      1440
     cctggaggag gcacggcggc gcaaggagaa tgaagtggaa gagtggcagc tccgggccaa      1500
     ggaagcccag gatgacctgg tgaagacccg ggaggagctg cacctggtga tgaccgcgcc      1560
     gccgccgcca ccggtgtacg agccggtgaa ctaccacgtg catgagggcc cgcaggagga      1620
     gggcacggag ctgagcgccg agctgtccag cgagggcatc ctggacgacc gcaacgagga      1680
     gaagcgcatc accgaggccg agaagaacga gcgcgtgcag cggcagctga tgactctgac      1740
     cagtgagctg tcccaggcca gagacgagaa caagcggacc cacaacgaca tcatccacaa      1800
     tgagaacatg aggcaaggcc gggacaagta caagacgctg cggcagatcc ggcaaggcaa      1860
     caccaagcag cgcatcgacg agttcgaggc catgtgaagg gtcgggcctc ggctccggcg      1920
     gcggccagtc cgccgccccg cgccgccccc agccctctgg ccgccaccct ctccctgctc      1980
     cgggtccttc accaaaagag cagttgcttc agtgggaatg ttctggggcc gggaccggcg      2040
     gcagtttccc tggtttattt ttcccaatgg tatcatagtg ccaaacaggc ctgattctta      2100
     tttttatttt tattgaatca cttcctgttt tttttttttt tgcttggagc aggatgaaat      2160
     caattaagga aagatgccta taaagtctga aataactaac tcctccatgc tggcatgtgt      2220
     gatacgagat tcagataatt aaaaccacat cgtggcttat attctgtgcc atactttttt      2280
     tctatctgaa actagccgaa attgattttc ttgatttcta tgaaggatcc acctctgtat      2340
     atttgttttt tgaagggtga aaagtttgac gcactcccta cgcacacaca ccatttcctt      2400
     cctctgaggc cttcagttca gttgacaaaa tcctgtgatc attggatccc tcaggataaa      2460
     caacgctgga tactgtactc tggataattt tttttttttt tttttgctta accc            2514
//

If you have problems or comments...

PBIL Back to PBIL home page