(data stored in ACNUC23119 zone)

EMBL: M99564

ID   M99564; SV 1; linear; mRNA; STD; HUM; 3070 BP.
XX
AC   M99564;
XX
DT   28-JAN-1993 (Rel. 34, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens (clone DN10mel) P protein mRNA, complete cds.
XX
KW   P gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3070
RX   DOI; 10.1038/361072a0.
RX   PUBMED; 8421497.
RA   Rinchik E.M., Bultman S.J., Horsthemke B., Lee S.-T., Strunk K.M.,
RA   Spritz R.A., Avidano K.A., Jong M.T.C., Nicholls R.D.;
RT   "A gene for the mouse pink-eyed dilution locus and for human type II
RT   oculocutaneous albinism";
RL   Nature 361(6407):72-76(1993).
XX
DR   MD5; b1f24002b14fe665787bdeee755c4d20.
DR   Ensembl-Gn; ENSG00000104044; homo_sapiens.
DR   Ensembl-Tr; ENST00000353809; homo_sapiens.
DR   Ensembl-Tr; ENST00000354638; homo_sapiens.
DR   EuropePMC; PMC2241744; 11719435.
DR   EuropePMC; PMC316542; 10783169.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3070
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="fetal, and adult"
FT                   /tissue_lib="cDNA of R. Neve"
FT                   /tissue_type="brain, and melanocyte"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..52
FT   CDS_pept        53..2569
FT                   /codon_start=1
FT                   /product="P protein"
FT                   /db_xref="GOA:Q04671"
FT                   /db_xref="H-InvDB:HIT000197043.14"
FT                   /db_xref="HGNC:HGNC:8101"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04671"
FT                   /protein_id="AAA36477.1"
FT                   /translation="MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGA
FT                   DPSHSCPRGAAGQSSWAPAGQEFASFLTKGRSHSSLPQMSSSRSKDSCFTENTPLLRNS
FT                   LQEKGSRCIPVYHPEFITAEESWEDSSADWERRYLLSREVSGLSASASSEKGDLLDSPH
FT                   IRLRLSKLRRCVQWLKVMGLFAFVVLCSILFSLYPDQGKLWQLLALSPLENYSVNLSSH
FT                   VDSTLLQVDLAGALVASGPSRPGREEHIVVELTQDDALGSRWRRPQQVTHNWTVYLNPR
FT                   RSEHSVMSRTFEVLTRETVSISIRASLQQTQAVPLLMAHQYLRGSVETQVTIATAILAG
FT                   VYALIIFEIVHRTLAAMLGSLAALAALAVIGDRPSLTHVVEWIDFETLALLFGMMILVA
FT                   IFSETGFFDYCAVKAYRLSRGRVWAMIIMLCLIAAVLSAFLDNVTTMLLFTPVTIRLCE
FT                   VLNLDPRQVLIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC
FT                   LVLLVCFPLLRLLYWNRKLYNKEPSEIVELKHEIHVWRLTAQRISPASREETAVRRLLL
FT                   GKVLALEHLLARRLHTFHRQISQEDKNWETNIQELQKKHRISDGILLAKCLTVLGFVIF
FT                   MFFLNSFVPGIHLDLGWIAILGAIWLLILADIHDFEIILHRVEWATLLFFAALFVLMEA
FT                   LAHLHLIEYVGEQTALLIKMVPEEQRLIAAIVLVVWVSALASSLIDNIPFTATMIPVLL
FT                   NLSHDPEVGLPAPPLMYALAFGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRL
FT                   GFPMMVVSCTVGMCYLLVAHVVVGWN"
FT   3'UTR           2570..3070
FT   regulatory      3061..3066
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 3070 BP; 694 A; 790 C; 808 G; 778 T; 0 other;
     cactcctgga gaaagatctg caagtgcgca gagagaagac tggcagtgga gcatgcatct        60
     ggagggcaga gacggcaggc ggtaccccgg cgcgccggcg gtggagctcc tgcagacgtc       120
     cgtgcccagc ggactcgctg aacttgtggc cggcaagcgc aggcttcctc ggggagccgg       180
     tggagctgac ccctcgcact cctgccccag gggggctgcc gggcagagct cttgggctcc       240
     tgcaggccag gagtttgctt cattcctcac aaaagggagg tctcactctt ctttgcccca       300
     gatgtccagc tccaggtcta aagattcctg ctttacagaa aacactcctt tgctgaggaa       360
     ttccttacag gagaaagggt cacggtgcat acctgtttac catccagagt tcatcactgc       420
     tgaagagtct tgggaagaca gctctgctga ctgggagcga agatacctgc taagcaggga       480
     ggtgtctggt ctgtctgcat ctgcctcctc cgagaaggga gaccttctgg acagcccgca       540
     catccgactc cgtctttcca agctgaggcg ctgtgtgcag tggctgaaag tcatgggcct       600
     gtttgccttt gtggtgctgt gttctatttt gttcagccta tatccggatc aaggaaagct       660
     ctggcagctg ttggccttat caccgctgga gaactactcc gtgaacctta gcagccacgt       720
     ggactccacg ctgctgcagg tggacctggc aggggcccta gtggccagtg ggccgagtcg       780
     tcctgggagg gaagagcaca tcgtggtgga gctgacccag gatgacgctt tgggctccag       840
     gtggcggcgg ccacagcagg tcactcacaa ctggacggtg tatttaaatc cgaggagaag       900
     cgagcactca gtgatgagca ggacctttga ggtactgacc agagagacgg tgtccatcag       960
     catccgggcc tccctgcagc agacccaggc tgtccctctt ttgatggctc atcagtacct      1020
     ccgcggaagt gtagaaaccc aggtgaccat cgcgacggcc atcctcgcgg gcgtctacgc      1080
     gctgatcata tttgagatcg tgcacagaac tctggcggcc atgctgggtt cccttgcagc      1140
     actggcagca ctggctgtga ttggcgatag acccagcctg acccatgtgg tggagtggat      1200
     tgattttgag acgctggccc tgctgtttgg catgatgatc ttagtagcca tattttcaga      1260
     aacgggattt ttcgattatt gtgctgtaaa ggcataccgg ctctcccggg gacgggtgtg      1320
     ggccatgatc atcatgctct gtctcatcgc ggccgtcctc tctgccttct tggacaacgt      1380
     caccaccatg ctcctcttca cgcctgtgac cataaggttg tgtgaggtgc tcaaccttga      1440
     tccaagacaa gtcctgattg cagaagtgat cttcacaaac attggaggag ctgccactgc      1500
     catcggggac cctccaaatg tcattattgt ttccaaccaa gagctgagga agatgggcct      1560
     ggactttgcc ggattcactg cacacatgtt cattgggatt tgccttgttc tcctggtctg      1620
     ctttccgctc ctcagactcc tttactggaa cagaaagctt tataacaagg aacccagtga      1680
     gattgttgaa ctgaagcacg agattcacgt ctggcgcctg actgctcagc gcatcagccc      1740
     ggccagccgc gaggagacag ctgtgcgccg cctgctgctg gggaaggtgc tggcactgga      1800
     gcacctgctc gcccggaggc tgcacacctt ccacagacag atctcacagg aggacaaaaa      1860
     ttgggagacc aatatccaag aactccaaaa aaagcatagg atatctgacg ggattctgct      1920
     cgccaaatgc ctgacagtgt tgggatttgt tatcttcatg tttttcctca attcgtttgt      1980
     ccctggcatt catcttgatc ttggatggat tgctattctg ggtgccatct ggttgctaat      2040
     tttagctgat attcatgatt ttgagataat tctacacaga gtggaatggg caacccttct      2100
     gttttttgca gcgctctttg ttctgatgga ggcattggca catctccact taatagaata      2160
     tgttggagaa caaactgctt tgctaataaa gatggtccca gaggagcagc gcctcatagc      2220
     cgccattgtc ctggtggtgt gggtctcagc cctggcgtcg tccctgattg acaacatccc      2280
     gttcactgct accatgattc ccgtgctcct gaacctgagc cacgaccctg aggttggcct      2340
     gcccgcaccg ccgctcatgt atgccctggc cttcggtgct tgcctgggag gcaacgggac      2400
     actgattggc gcgtcggcaa acgtcgtgtg tgcagggatt gcagaacagc atggatatgg      2460
     gttctccttc atggaatttt tcaggctggg cttcccaatg atggttgtgt cctgcactgt      2520
     tgggatgtgt tatctccttg tggctcatgt ggtggtggga tggaattaat agacatccat      2580
     ctattgctcg aagactaaag gaaacttcat ccatcacaac ccattagtca taaaactacc      2640
     ctgaccccac tgtttgaaga agaaaaggtg cttaccctgg agatgctaca gagacacagt      2700
     ggaatagacc ttgacactaa cactctaatt caagcgaatg ttggaacacc atgacctcct      2760
     ctgtgtgtcc tttctcccca aggacaaaat gtagaaagat gtgagataac ttactcaaga      2820
     ttcccctcca gaaaaatacg tatgtttaaa aacccttcct gctatacata ggaaaagaca      2880
     cacatccacc taaaattgac tgtactgttt aactgtcaat tctcctgagg ctaaacacag      2940
     tttgtttttc ttgtaatcac ttttcatgtt aaaataatca gcattcaaat tgtatgcttt      3000
     ctgaatatag actttctggg aaaaggttta ctgctcgtaa ggaaacattt tatgtattaa      3060
     aataaactgt                                                             3070
//

If you have problems or comments...

PBIL Back to PBIL home page