(data stored in ACNUC11016 zone)

SWISSPROT: AXA81_HUMAN

ID   AXA81_HUMAN             Reviewed;         327 AA.
AC   Q5VT79; A0A0B4J2D4; B2R939; Q53FY2; Q5VT78; Q96H89;
DT   08-APR-2008, integrated into UniProtKB/Swiss-Prot.
DT   22-JUL-2015, sequence version 2.
DT   08-MAY-2019, entry version 126.
DE   RecName: Full=Annexin A8-like protein 1 {ECO:0000305};
GN   Name=ANXA8L1 {ECO:0000312|HGNC:HGNC:23334};
GN   Synonyms=ANXA8L2 {ECO:0000312|HGNC:HGNC:23334};
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1] {ECO:0000305, ECO:0000312|EMBL:BAD96869.1}
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
RP   VAL-134.
RC   TISSUE=Lung {ECO:0000312|EMBL:BAD96869.1};
RA   Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y.,
RA   Tanaka A., Yokoyama S.;
RL   Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases.
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
RP   VAL-134.
RC   TISSUE=Trachea;
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
RA   Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
RA   Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
RA   Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
RA   Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
RA   Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
RA   Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
RA   Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
RA   Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
RA   Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
RA   Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
RA   Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
RA   Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
RA   Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
RA   Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
RA   Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
RA   Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
RA   Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
RA   Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [3] {ECO:0000312|EMBL:CAH70574.1}
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], AND VARIANT ASN-192.
RX   PubMed=15164054; DOI=10.1038/nature02462;
RA   Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L.,
RA   Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K.,
RA   Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L.,
RA   Taylor A., Battles J., Bird C.P., Ainscough R., Almeida J.P.,
RA   Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J.,
RA   Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J.,
RA   Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D.,
RA   Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S.,
RA   Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L.,
RA   Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S.,
RA   Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L.,
RA   Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J.,
RA   Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M.,
RA   Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S.,
RA   Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M.,
RA   Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A.,
RA   Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T.,
RA   Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I.,
RA   Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T.,
RA   Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M.,
RA   Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W.,
RA   Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H.,
RA   Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L.,
RA   Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K.,
RA   Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T.,
RA   Doucette-Stamm L., Beck S., Smith D.R., Rogers J.;
RT   "The DNA sequence and comparative analysis of human chromosome 10.";
RL   Nature 429:375-381(2004).
RN   [4] {ECO:0000305, ECO:0000312|EMBL:AAH08813.3}
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
RC   TISSUE=Placenta {ECO:0000312|EMBL:AAH08813.3};
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=2;
CC       Name=1 {ECO:0000269|PubMed:15164054};
CC         IsoId=Q5VT79-1; Sequence=Displayed;
CC         Note=No experimental confirmation available. {ECO:0000305};
CC       Name=2 {ECO:0000269|PubMed:15164054, ECO:0000269|PubMed:15489334};
CC         IsoId=Q5VT79-2; Sequence=VSP_052782, VSP_052783, VSP_052784;
CC         Note=No experimental confirmation available. {ECO:0000305};
CC   -!- DOMAIN: A pair of annexin repeats may form one binding site for
CC       calcium and phospholipid. {ECO:0000250|UniProtKB:P13928}.
CC   -!- SIMILARITY: Belongs to the annexin family. {ECO:0000255}.
DR   EMBL; AK223149; BAD96869.1; -; mRNA.
DR   EMBL; AK313626; BAG36386.1; -; mRNA.
DR   EMBL; AC244230; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AL603965; CAH70574.1; -; Genomic_DNA.
DR   EMBL; AL603965; CAH70575.1; -; Genomic_DNA.
DR   EMBL; AL732434; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; BC008813; AAH08813.3; -; mRNA.
DR   CCDS; CCDS73097.1; -. [Q5VT79-2]
DR   CCDS; CCDS73098.1; -. [Q5VT79-1]
DR   RefSeq; NP_001092315.2; NM_001098845.2. [Q5VT79-1]
DR   RefSeq; NP_001265853.1; NM_001278924.1. [Q5VT79-2]
DR   SMR; Q5VT79; -.
DR   BioGrid; 608549; 9.
DR   IntAct; Q5VT79; 1.
DR   STRING; 9606.ENSP00000480221; -.
DR   iPTMnet; Q5VT79; -.
DR   PhosphoSitePlus; Q5VT79; -.
DR   SwissPalm; Q5VT79; -.
DR   BioMuta; ANXA8L1; -.
DR   DMDM; 74756781; -.
DR   EPD; Q5VT79; -.
DR   jPOST; Q5VT79; -.
DR   PaxDb; Q5VT79; -.
DR   PeptideAtlas; Q5VT79; -.
DR   PRIDE; Q5VT79; -.
DR   ProteomicsDB; 65310; -.
DR   ProteomicsDB; 65311; -. [Q5VT79-2]
DR   DNASU; 244; -.
DR   Ensembl; ENST00000619162; ENSP00000480221; ENSG00000264230. [Q5VT79-1]
DR   Ensembl; ENST00000622769; ENSP00000483608; ENSG00000264230. [Q5VT79-2]
DR   GeneID; 728113; -.
DR   KEGG; hsa:728113; -.
DR   CTD; 728113; -.
DR   DisGeNET; 653145; -.
DR   DisGeNET; 728113; -.
DR   GeneCards; ANXA8L1; -.
DR   HGNC; HGNC:23334; ANXA8L1.
DR   HPA; HPA045246; -.
DR   HPA; HPA047451; -.
DR   neXtProt; NX_Q5VT79; -.
DR   OpenTargets; ENSG00000264230; -.
DR   PharmGKB; PA134927491; -.
DR   eggNOG; KOG0819; Eukaryota.
DR   eggNOG; ENOG410XPUN; LUCA.
DR   GeneTree; ENSGT00940000161044; -.
DR   HOGENOM; HOG000158803; -.
DR   InParanoid; Q5VT79; -.
DR   KO; K17096; -.
DR   OrthoDB; 856254at2759; -.
DR   TreeFam; TF105452; -.
DR   ChiTaRS; ANXA8L1; human.
DR   GenomeRNAi; 728113; -.
DR   PRO; PR:Q5VT79; -.
DR   Proteomes; UP000005640; Chromosome 10.
DR   Bgee; ENSG00000264230; Expressed in 82 organ(s), highest expression level in skin of abdomen.
DR   ExpressionAtlas; Q5VT79; baseline and differential.
DR   GO; GO:0005623; C:cell; IEA:GOC.
DR   GO; GO:0051015; F:actin filament binding; IBA:GO_Central.
DR   GO; GO:0005509; F:calcium ion binding; IBA:GO_Central.
DR   GO; GO:0005544; F:calcium-dependent phospholipid binding; IBA:GO_Central.
DR   GO; GO:0005547; F:phosphatidylinositol-3,4,5-trisphosphate binding; IBA:GO_Central.
DR   GO; GO:0043325; F:phosphatidylinositol-3,4-bisphosphate binding; IBA:GO_Central.
DR   GO; GO:0005546; F:phosphatidylinositol-4,5-bisphosphate binding; IBA:GO_Central.
DR   GO; GO:0016197; P:endosomal transport; IBA:GO_Central.
DR   GO; GO:0007032; P:endosome organization; IBA:GO_Central.
DR   GO; GO:1900138; P:negative regulation of phospholipase A2 activity; IBA:GO_Central.
DR   GO; GO:1900004; P:negative regulation of serine-type endopeptidase activity; IBA:GO_Central.
DR   Gene3D; 1.10.220.10; -; 4.
DR   InterPro; IPR001464; Annexin.
DR   InterPro; IPR018502; Annexin_repeat.
DR   InterPro; IPR018252; Annexin_repeat_CS.
DR   InterPro; IPR037104; Annexin_sf.
DR   InterPro; IPR009115; ANX8.
DR   PANTHER; PTHR10502:SF133; PTHR10502:SF133; 1.
DR   Pfam; PF00191; Annexin; 4.
DR   PRINTS; PR00196; ANNEXIN.
DR   PRINTS; PR01808; ANNEXINVIII.
DR   SMART; SM00335; ANX; 4.
DR   PROSITE; PS00223; ANNEXIN; 4.
PE   2: Evidence at transcript level;
DR   PRODOM; Q5VT79.
DR   SWISS-2DPAGE; Q5VT79.
KW   Alternative splicing; Annexin; Calcium; Calcium/phospholipid-binding;
KW   Complete proteome; Metal-binding; Polymorphism; Reference proteome;
KW   Repeat.
FT   CHAIN         1    327       Annexin A8-like protein 1.
FT                                /FTId=PRO_0000328939.
FT   REPEAT       25     90       Annexin 1. {ECO:0000255}.
FT   REPEAT       97    162       Annexin 2. {ECO:0000255}.
FT   REPEAT      181    247       Annexin 3. {ECO:0000255}.
FT   REPEAT      257    322       Annexin 4. {ECO:0000255}.
FT   METAL       266    266       Calcium; via carbonyl oxygen.
FT                                {ECO:0000250}.
FT   METAL       268    268       Calcium; via carbonyl oxygen.
FT                                {ECO:0000250}.
FT   METAL       270    270       Calcium; via carbonyl oxygen.
FT                                {ECO:0000250}.
FT   METAL       310    310       Calcium. {ECO:0000250}.
FT   VAR_SEQ      38     38       G -> GVGSQLLSHQAAAFAFPSSALTSVSPWGQQGHLCCN
FT                                PAG (in isoform 2).
FT                                {ECO:0000303|PubMed:15164054,
FT                                ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_052782.
FT   VAR_SEQ     109    165       Missing (in isoform 2).
FT                                {ECO:0000303|PubMed:15164054,
FT                                ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_052783.
FT   VAR_SEQ     217    248       Missing (in isoform 2).
FT                                {ECO:0000303|PubMed:15164054,
FT                                ECO:0000303|PubMed:15489334}.
FT                                /FTId=VSP_052784.
FT   VARIANT     134    134       A -> V (in dbSNP:rs201596209).
FT                                {ECO:0000269|PubMed:14702039,
FT                                ECO:0000269|Ref.1}.
FT                                /FTId=VAR_067447.
FT   VARIANT     177    177       A -> G (in dbSNP:rs3013886).
FT                                /FTId=VAR_048254.
FT   VARIANT     192    192       K -> N (in dbSNP:rs977788).
FT                                {ECO:0000269|PubMed:15164054}.
FT                                /FTId=VAR_067448.
SQ   SEQUENCE   327 AA;  36879 MW;  3AAEE1D7072A9379 CRC64;
     MAWWKAWIEQ EGVTVKSSSH FNPDPDAETL YKAMKGIGTN EQAIIDVLTK RSNTQRQQIA
     KSFKAQFGKD LTETLKSELS GKFERLIVAL MYPPYRYEAK ELHDAMKGLG TKEGVIIEIL
     ASRTKNQLRE IMKAYEEDYG SSLEEDIQAD TSGYLERILV CLLQGSRDDV SSFVDPALAL
     QDAQDLYAAG EKIRGTDEMK FITILCTRSA THLLRVFEEY EKIANKSIED SIKSETHGSL
     EEAMLTVVKC TQNLHSYFAE RLYYAMKGAG TRDGTLIRNI VSRSEIDLNL IKCHFKKMYG
     KTLSSMIMED TSGDYKNALL SLVGSDP
//

If you have problems or comments...

PBIL Back to PBIL home page