(data stored in ACNUC14238 zone)

EMBL: S61948

ID   S61948; SV 1; linear; mRNA; STD; ROD; 2097 BP.
XX
AC   S61948;
XX
DT   30-NOV-1993 (Rel. 37, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   smooth muscle myosin heavy chain isoform SM1A {S1 head region,
DE   alternatively spliced, clone SMHC-5} [rats, stomach, mRNA Partial, 2097 nt]
XX
KW   .
XX
OS   Rattus sp.
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus; unclassified Rattus.
XX
RN   [1]
RP   1-2097
RA   White S., Martin A.F., Periasamy M.;
RT   "Identification of a novel smooth muscle myosin heavy chain cDNA: isoform
RT   diversity in the S1 head region";
RL   Am. J. Physiol. 264:8-8(1993).
XX
DR   MD5; 7c5a29881ddf752cae5587a166a377f4.
XX
CC   This entry [NCBI gibbsq 133093] was created by the journal scanning
CC   component of NCBI/GenBank at the National Library of Medicine. This
CC   sequence comes from Fig. 2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2097
FT                   /organism="Rattus sp."
FT                   /mol_type="mRNA"
FT                   /note="rats"
FT                   /db_xref="taxon:10118"
FT   CDS_pept        1..2097
FT                   /partial
FT                   /codon_start=1
FT                   /product="smooth muscle myosin heavy chain isoform SM1A"
FT                   /note="SMHC SM1A;  For the protein sequence (NCBI gibbsq
FT                   133094):  Method: conceptual translation supplied by
FT                   author.  This sequence comes from Fig. 2."
FT                   /db_xref="GOA:Q63862"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002928"
FT                   /db_xref="InterPro:IPR027401"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63862"
FT                   /protein_id="AAB26775.1"
FT                   /translation="KKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTK
FT                   KVIQYLAVVASSHKGKKDSSITGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRI
FT                   NFDVTGYIVGANIETYLLEKSRAIRHARDERTFHIFYYLIAGAKEKMRNDLLLESFNSY
FT                   TFLSNGFVPIPAAQDDEMFQETLEAMSIMGFSEEEQLAILKVVSSVLQLGNIVFKKERN
FT                   TDQASMPDNTAAQKVCHLVGINVTDFTRAILTPRIKVGRDVVQKAQTKEQADFAIEALA
FT                   KATYERLFRWILSRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQ
FT                   QLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECWFPK
FT                   ATDKSFVEKLCSEQGNHPKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLTKNMDPLNDN
FT                   VTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQL
FT                   GKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIV
FT                   FQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLE
FT                   EERDLKITDVIMAFQAMCRGYLARKAFTKRQQQLTASKVIQRNCAAYLKLRNWQWWRLF
FT                   TKVKP"
XX
SQ   Sequence 2097 BP; 578 A; 529 C; 533 G; 457 T; 0 other;
     aagaagaggc atgagatgcc gcctcacatc tatgccattg ctgatacggc ctacagaagc        60
     atgctacaag atcgtgaaga ccagtccatt ctgtgcacag gtgagtctgg agctggaaag       120
     acagagaaca caaagaaagt catacagtat ttggctgtgg tggcatcctc ccacaaaggc       180
     aagaaagaca gcagcatcac gggggagctg gaaaagcagc ttctacaggc aaacccaatc       240
     ctggaggctt tcggcaatgc aaaaactgtc aagaatgaca actcctcccg ctttggcaag       300
     ttcattcgca tcaactttga tgtcactggt tacattgtgg gtgccaatat cgaaacatat       360
     cttctggaaa agtctcgggc tattcgacat gctagggacg agagaacgtt ccacatcttc       420
     tactatctga tcgctggagc caaggagaag atgagaaatg acctactttt ggagagcttc       480
     aacagctaca catttttatc caatggcttt gtgcccatcc cagctgcaca agatgatgag       540
     atgttccagg agacactaga ggccatgtcc atcatgggct tcagtgaaga ggaacagcta       600
     gccatcttga aggtagtatc atccgtcctt cagcttggaa acattgtctt caagaaggag       660
     cgaaacacag accaggcatc catgcctgat aacacagctg ctcagaaagt ttgccacctt       720
     gtgggaatta atgtgacaga tttcaccaga gccatcctga ccccacgtat aaaagttgga       780
     cgggatgtgg tgcagaaagc tcagaccaaa gaacaggctg actttgccat tgaggcctta       840
     gccaaggcca cttatgagcg ccttttccga tggattctca gccgtgtgaa caaagccttg       900
     gataagaccc atcgtcaggg ggcctccttc ctgggcattc tggatattgc tgggtttgaa       960
     atctttgagg taaactcctt cgagcagctg tgcatcaact acaccaatga gaagttgcag      1020
     cagctgttca atcacaccat gttcatcctg gagcaggaag agtaccaacg agagggcatc      1080
     gagtggaact tcatcgactt tggcctggac ctacagcctt gtattgaact gattgagcgg      1140
     ccgaacaacc ctcctggtgt gctggccctg ctggatgaag aatgctggtt ccccaaagct      1200
     acggacaagt cttttgtgga gaagctgtgc tcagagcagg gcaatcaccc caaatttcag      1260
     aagcccaagc agctaaagga caaaacagag ttctccatca tccactatgc tgggaaggtg      1320
     gactataatg caagtgcgtg gctgaccaag aacatggacc cgctaaatga taatgtgacc      1380
     tcactcctca atgcctcctc ggacaagttt gtggccgacc tgtggaagga tgtggaccgc      1440
     attgtggggt tggaccagat ggccaagatg actgagagct cactgcccag tgcctccaag      1500
     accaaaaagg gcatgttccg caccgtgggc cagctctaca aagagcagct ggggaagctg      1560
     atgaccacac tgcgcaacac cacgcctaac tttgtgcgct gcatcatccc caaccatgaa      1620
     aagaggtctg gcaagctgga tgcatttcta gttctggagc agctgcggtg caatggtgtg      1680
     ttggaaggca tccgcatctg ccgtcagggc ttccccaaca ggattgtctt ccaagagttc      1740
     cggcaacgct acgagatcct ggcagcgaac gccatcccca aaggcttcat ggatggaaag      1800
     caagcctgca ttctcatgat caaagccctt gaacttgacc ccaatctgta caggattggg      1860
     cagagcaaaa tcttctttcg tacgggagtc ctggcccacc tagaggaaga acgagacctg      1920
     aagattactg atgtcatcat ggctttccag gcaatgtgtc gtggctacct ggccagaaaa      1980
     gccttcacca agaggcagca acagttaaca gccagtaagg tgatccagag gaactgcgct      2040
     gcctacctta aactccgcaa ctggcaatgg tggaggctct tcactaaagt aaagccg         2097
//

If you have problems or comments...

PBIL Back to PBIL home page