(data stored in ACNUC27125 zone)

EMBL: S68287

ID   S68287; SV 1; linear; mRNA; STD; HUM; 1167 BP.
XX
AC   S68287;
XX
DT   27-SEP-1994 (Rel. 41, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   chlordecone reductase {clone HAKRa} [human, liver, mRNA, 1167 nt].
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 143363] from the original journal article.
RP   1-1167
RX   DOI; 10.1016/0960-0760(93)90308-J.
RX   PUBMED; 8274401.
RA   Qin K.N., New M.I., Cheng K.C.;
RT   "Molecular cloning of multiple cDNAs encoding human enzymes structurally
RT   related to 3 alpha-hydroxysteroid dehydrogenase";
RL   J. Steroid Biochem. Mol. Biol. 46(6):673-679(1993).
XX
DR   MD5; 236ff26270cc82eea6fa77d382a4754b.
DR   Ensembl-Gn; ENSG00000198610; homo_sapiens.
DR   Ensembl-Tr; ENST00000263126; homo_sapiens.
DR   Ensembl-Tr; ENST00000380448; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1167
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..1167
FT                   /gene="chlordecone reductase"
FT   CDS_pept        8..979
FT                   /codon_start=1
FT                   /gene="chlordecone reductase"
FT                   /db_xref="GOA:P17516"
FT                   /db_xref="H-InvDB:HIT000216246.14"
FT                   /db_xref="HGNC:HGNC:387"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="PDB:2FVL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17516"
FT                   /protein_id="AAD14010.1"
FT                   /translation="MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAG
FT                   FRHIDSAYLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQMVQPALESSLK
FT                   KLQLDYVDLYLLHFPMALKPGETPLPKDENGKVIFDTVDLSATWEVMEKCKDAGLAKSI
FT                   GVSNFNCRQLEMILNKPGLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQ
FT                   RHKLWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENI
FT                   QVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPFSDEY"
XX
SQ   Sequence 1167 BP; 334 A; 266 C; 274 G; 293 T; 0 other;
     gcaagcaatg gatcccaaat atcagcgtgt agagctaaat gatggtcatt tcatgcccgt        60
     attgggattt ggcacctatg cacctccaga ggttccgagg aacagagctg tagaggtcac       120
     caaattagca atagaagctg gcttccgcca tattgattct gcttatttat acaataatga       180
     ggagcaggtt ggactggcca tccgaagcaa gattgcagat ggcagtgtga agagagaaga       240
     catattctac acttcaaagc tttggtgcac tttctttcaa ccacagatgg tccaaccagc       300
     cttggaaagc tcactgaaaa aacttcaact ggactatgtt gacctctatc ttcttcattt       360
     cccaatggct ctcaagccag gtgagacgcc actaccaaaa gatgaaaatg gaaaagtaat       420
     attcgacaca gtggatctct ctgccacatg ggaggtcatg gagaagtgta aggatgcagg       480
     attggccaag tccatcgggg tgtcaaactt caactgcagg cagctggaga tgatcctcaa       540
     caagccagga ctcaagtaca agcctgtctg caaccaggta gaatgtcatc cttacctcaa       600
     ccagagcaaa ctgctggatt tctgcaagtc aaaagacatt gttctggttg cccacagtgc       660
     tctgggaacc caacgacata aactatgggt ggacccaaac tccccagttc ttttggagga       720
     cccagttctt tgtgccttag caaagaaaca caaacgaacc ccagccctga ttgccctgcg       780
     ctaccagctg cagcgtgggg ttgtggtcct ggccaagagc tacaatgagc agcggatcag       840
     agagaacatc caggtttttg aattccagtt gacatcagag gatatgaaag ttctagatgg       900
     tctaaacaga aattatcgat atgttgtcat ggattttctt atggaccatc ctgattatcc       960
     attttcagat gaatattagc atagagggtg ttgcacgaca tctagcagaa ggccctgtgg      1020
     tgtggatggt gatgcagagg atgtctctat gctggtgact ggacacacgg cctctggtta      1080
     aatccctccc ctcctgcttg gcaacttcag ctagctagat atatccatgg tccagaaagc      1140
     aaacataata aatttttatc ttgaagt                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page