(data stored in ACNUC9552 zone)

EMBL: S74122

ID   S74122; SV 1; linear; mRNA; STD; ROD; 464 BP.
XX
AC   S74122;
XX
DT   28-MAR-1995 (Rel. 43, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 6)
XX
DE   bcl-2=proto-oncogene [rats, Wistar, mRNA Partial, 464 nt].
XX
KW   .
XX
OS   Rattus sp.
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus; unclassified Rattus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 157713] from the original journal article. This sequence comes from
RC   Fig. 1.
RP   1-464
RX   DOI; 10.1016/0306-4522(94)90069-8.
RX   PUBMED; 7969891.
RA   Castren E., Ohga Y., Berzaghi M.P., Tzimagiorgis G., Thoenen H.,
RA   Lindholm D.;
RT   "bcl-2 messenger RNA is localized in neurons of the developing and adult
RT   rat brain";
RL   Neuroscience 61(1):165-177(1994).
XX
DR   MD5; 724a4f78d877122b5bd846c0ee3338f8.
DR   GOA; P49950.
DR   InterPro; IPR002475; Bcl2-like.
DR   InterPro; IPR004725; Bcl2/BclX.
DR   InterPro; IPR020717; Bcl2_BH1_motif_CS.
DR   InterPro; IPR020726; Bcl2_BH2_motif_CS.
DR   InterPro; IPR020731; Bcl2_BH4_motif_CS.
DR   InterPro; IPR026298; Blc2_fam.
DR   UniProtKB/Swiss-Prot; P49950; BCL2_RAT.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..464
FT                   /organism="Rattus sp."
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10118"
FT   CDS_pept        <1..>464
FT                   /codon_start=2
FT                   /gene="bcl-2"
FT                   /product="bcl-2"
FT                   /note="This sequence comes from Fig. 1"
FT                   /db_xref="GOA:Q6LD89"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR013278"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020728"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR036834"
FT                   /db_xref="UniProtKB/TrEMBL:Q6LD89"
FT                   /protein_id="AAP21091.1"
FT                   /translation="IHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHR
FT                   DTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFT
FT                   ARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIAL"
XX
SQ   Sequence 464 BP; 76 A; 145 C; 147 G; 96 T; 0 other;
     catccattat aagctgtcgc agaggggcta cgagtgggat actggagatg aagactccgc        60
     gcccctgagg gctgccccca cccctggcat cttctccttc cagcctgaga gcaaccggac       120
     gcccgctgtg caccgagaca cggctgccag gacgtcgcct ctacggcccc ttgtcgccaa       180
     cgctgggcct gcgctcagcc ctgtgccacc tgtggtccac ctgaccctcc gccgggctgg       240
     ggatgacttc tctcgtcgct accgtcgcga ctttgcagag atgtccagtc agctgcacct       300
     gacgcccttc accgcgaggg gacgctttgc cacggtggtg gaggaactct tcagggatgg       360
     ggtgaactgg gggaggattg tggccttctt tgagttcggt ggggtcatgt gtgtggagag       420
     cgtcaacagg gagatgtcac ccctggtgga caacatcgct ctgt                        464
//

If you have problems or comments...

PBIL Back to PBIL home page