(data stored in ACNUC9552 zone)

EMBL: S76513

ID   S76513; SV 1; linear; mRNA; STD; ROD; 726 BP.
XX
AC   S76513;
XX
DT   12-NOV-1995 (Rel. 45, Created)
DT   01-SEP-2004 (Rel. 81, Last updated, Version 5)
XX
DE   bcl-x=apoptosis inhibitor {protooncogene} [rats, ovary, mRNA Partial, 726
DE   nt].
XX
KW   .
XX
OS   Rattus sp.
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus; unclassified Rattus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 162917] from the original journal article.
RP   1-726
RX   DOI; 10.1210/en.136.1.232.
RX   PUBMED; 7828536.
RA   Tilly J.L., Tilly K.I., Kenton M.L., Johnson A.L.;
RT   "Expression of members of the bcl-2 gene family in the immature rat ovary:
RT   equine chorionic gonadotropin-mediated inhibition of granulosa cell
RT   apoptosis is associated with decreased bax and constitutive bcl-2 and
RT   bcl-xlong messenger ribonucleic acid levels";
RL   Endocrinology 136(1):232-241(1995).
XX
DR   MD5; bb26981afd5ba655c8f45e8a16aa8e54.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..726
FT                   /organism="Rattus sp."
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10118"
FT   gene            <1..726
FT                   /gene="bcl-x"
FT   CDS_pept        <1..721
FT                   /codon_start=2
FT                   /gene="bcl-x"
FT                   /note="apoptosis inhibitor; conceptual translation
FT                   presented here differs from translation in publication"
FT                   /db_xref="GOA:P53563"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR004725"
FT                   /db_xref="InterPro:IPR013279"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="InterPro:IPR020728"
FT                   /db_xref="InterPro:IPR020731"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR036834"
FT                   /db_xref="PDB:1AF3"
FT                   /db_xref="PDB:4QNQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53563"
FT                   /protein_id="AAC60701.2"
FT                   /translation="PISIIKMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPE
FT                   ETEPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVLPMAAVKQALREAGDEFE
FT                   LRYRRAFSDLTSQLHITPGTVYQSFEQVVNELFRDGVNWGRIVASSSFGGALCVESVDK
FT                   EMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNTAPESRKGQERFNRWFLT
FT                   GMTVAGVVLLGSLFSRK"
XX
SQ   Sequence 726 BP; 181 A; 177 C; 220 G; 148 T; 0 other;
     gcccatctct attataaaaa tgtctcagag caaccgggag ctggtggttg actttctctc        60
     ctacaagctc tcccagaaag gatacagctg gagtcagttt agcgatgtcg aagagaacag       120
     gactgaagcc ccagaagaaa ctgaaccaga aagggagacc cccagtgcca tcaatggcaa       180
     cccatcctgg cacctggcgg atagccccgc ggtgaatgga gccactggcc acagcagcag       240
     tttggatgcg cgggaggtac tccccatggc agcagtgaag caagcgctga gagaggctgg       300
     cgatgagttt gaactgcggt accggagagc attcagtgat ctaacatccc agcttcatat       360
     aaccccaggg acagtatatc agagctttga acaggtagtg aatgaactct ttcgggatgg       420
     ggtaaactgg ggtcgcattg tggcctcctc ctcctttggg ggggcactgt gcgtggaaag       480
     cgtagacaag gagatgcagg tattggtgag tcggattgca agttggatgg ccacctacct       540
     gaatgaccac ctagagcctt ggatccagga gaacggcggc tgggacactt ttgtggatct       600
     ctacgggaac aatacagcac ccgagagccg gaaaggccag gagcgtttca accgctggtt       660
     cctgacgggc atgactgtgg ctggtgtagt tctgctgggc tcactcttca gtcggaagtg       720
     accaga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page