(data stored in ACNUC9552 zone)

EMBL: S78284

ID   S78284; SV 1; linear; mRNA; STD; ROD; 537 BP.
XX
AC   S78284;
XX
DT   12-NOV-1995 (Rel. 45, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   bcl-xshort=apoptosis inducer [rats, ovary, mRNA Partial, 537 nt].
XX
KW   .
XX
OS   Rattus sp.
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus; unclassified Rattus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 162923] from the original journal article.
RP   1-537
RX   DOI; 10.1210/en.136.1.232.
RX   PUBMED; 7828536.
RA   Tilly J.L., Tilly K.I., Kenton M.L., Johnson A.L.;
RT   "Expression of members of the bcl-2 gene family in the immature rat ovary:
RT   equine chorionic gonadotropin-mediated inhibition of granulosa cell
RT   apoptosis is associated with decreased bax and constitutive bcl-2 and
RT   bcl-xlong messenger ribonucleic acid levels";
RL   Endocrinology 136(1):232-241(1995).
XX
DR   MD5; f88653b4c0ebd7dcea99ce1fce981595.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..537
FT                   /organism="Rattus sp."
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10118"
FT   CDS_pept        2..532
FT                   /partial
FT                   /codon_start=1
FT                   /gene="bcl-xshort"
FT                   /note="apoptosis inducer; This sequence comes from Fig. 2"
FT                   /db_xref="GOA:P53563"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR004725"
FT                   /db_xref="InterPro:IPR013279"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="InterPro:IPR020728"
FT                   /db_xref="InterPro:IPR020731"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR036834"
FT                   /db_xref="PDB:1AF3"
FT                   /db_xref="PDB:4QNQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53563"
FT                   /protein_id="AAC60702.1"
FT                   /translation="PISIIKMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPE
FT                   ETEPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVLPMAAVKQALREAGDEFE
FT                   LRYRRAFSDLTSQLHITPGTVYQSFEQDTFVDLYGNNTAPESRKGQERFNRWFLTGMTV
FT                   AGVVLLGSLFSRK"
XX
SQ   Sequence 537 BP; 141 A; 138 C; 153 G; 105 T; 0 other;
     gcccatctct attataaaaa tgtctcagag caaccgggag ctggtggttg actttctctc        60
     ctacaagctc tcccagaaag gatacagctg gagtcagttt agcgatgtcg aagagaacag       120
     gactgaagcc ccagaagaaa ctgaaccaga aagggagacc cccagtgcca tcaatggcaa       180
     cccatcctgg cacctggcgg atagccccgc ggtgaatgga gccactggcc acagcagcag       240
     tttggatgcg cgggaggtac tccccatggc agcagtgaag caagcgctga gagaggctgg       300
     cgatgagttt gaactgcggt accggagagc attcagtgat ctaacatccc agcttcatat       360
     aaccccaggg acagtatatc agagctttga acaggacact tttgtggatc tctacgggaa       420
     caatacagca cccgagagcc ggaaaggcca ggagcgtttc aaccgctggt tcctgacggg       480
     catgactgtg gctggtgtag ttctgctggg ctcactcttc agtcggaagt gaccaga          537
//

If you have problems or comments...

PBIL Back to PBIL home page