(data stored in ACNUC16935 zone)

EMBL: AH005059

ID   AH005059; SV 2; linear; mRNA; STD; PLN; 523 BP.
XX
AC   AH005059; S82312-S82313;
XX
DT   08-APR-2016 (Rel. 128, Created)
DT   29-JUL-2016 (Rel. 129, Last updated, Version 2)
XX
DE   Zea mays cultivar INRA 258 polyubiquitin homolog mRNAs, partial cds.
XX
KW   .
XX
OS   Zea mays
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade;
OC   Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea.
XX
RN   [1]
RP   1-523
RX   DOI; 10.1007/BF00196874.
RX   PUBMED; 8680303.
RA   Didierjean L., Frendo P., Nasser W., Genot G., Marivet J., Burkard G.;
RT   "Heavy-metal-responsive genes in maize: identification and comparison of
RT   their expression upon various forms of abiotic stress";
RL   Planta 199(1):1-8(1996).
XX
DR   MD5; fdac30ec67ad68e43f49b65795865a7c.
XX
CC   On or before Apr 6, 2016 this sequence version replaced gi:1839582,
CC   gi:1839583, gi:1839586.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..523
FT                   /organism="Zea mays"
FT                   /cultivar="INRA 258"
FT                   /mol_type="mRNA"
FT                   /tissue_type="leaves"
FT                   /note="mercuric chloride-treated"
FT                   /db_xref="taxon:4577"
FT   CDS_pept        85..>199
FT                   /codon_start=1
FT                   /product="polyubiquitin homolog"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SAT2"
FT                   /protein_id="AAB47174.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP"
FT   gap             200..299
FT                   /estimated_length=unknown
FT   CDS_pept        <300..338
FT                   /codon_start=1
FT                   /product="polyubiquitin homolog"
FT                   /db_xref="UniProtKB/TrEMBL:Q93X21"
FT                   /protein_id="AAB47175.1"
FT                   /translation="HPPPGARLRGGY"
XX
SQ   Sequence 523 BP; 81 A; 123 C; 102 G; 117 T; 100 other;
     cttgggcgta cggacacagc cccgatccga atcgtcctcc tcgcgagcct cgtcgatccc        60
     ccactcccct cccctcgctt caagatgcag atctttgtga agaccctcac cggcaagact       120
     atcaccctcg aggtggagtc ttctgacacc attgacaatg tcaaggctaa gatccaggac       180
     aaggagggca tccctcctgn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       240
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnc       300
     accctccacc tggtgctcgt cttcgcggtg gttattaagc catcagtcgt tgaagctgct       360
     gctgctgtat ctgggttatc tagtgtctct gccattgccc atggatggta ctgtctttca       420
     aagtatttgt atggtttgtg tcgtgagtcg tgactgagct ggtttcatgg accagttgtg       480
     ttctcgttac ccaaaactat cgtgcgaccg catatggctt aat                         523
//

If you have problems or comments...

PBIL Back to PBIL home page